Property Summary

NCBI Gene PubMed Count 16
PubMed Score 224.29
PubTator Score 1660.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (7)

PMID Text
26324884 Chronophin has a role in coordinating cell leading edge dynamics by controlling active cofilin levels
23223568 Splicing of SH3BP1 and CIN gene loci produces the novel brain specific splice variant BGIN.
19000834 Study demonstrates the ATP-sensitive interaction of the cofilin phosphatase chronophin (CIN) with the chaperone hsp90 to form a biosensor that mediates cofilin/actin rod formation.
18510874 Results suggest that the transduction of the PEP-1-PLPP fusion protein can be one mode of PLP level regulation, and to replenish this enzyme in the various neurological disorders related to vitamin B(6).
16336786 analysis of brain pyridoxal-5'-phosphate phosphatase
15580268 We report the biochemical isolation of chronophin (CIN), a unique cofilin-activating phosphatase of the haloacid dehalogenase (HAD) superfamily and an important novel regulator of cofilin-mediated actin reorganization.
14522954 analysis of pyridoxal phosphatase cloning, expression and tissue distribution

AA Sequence

MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGERAVPGAPELLERLARAGKAALFVSNNSRRARPELAL      1 - 70
RFARLGFGGLRAEQLFSSALCAARLLRQRLPGPPDAPGAVFVLGGEGLRAELRAAGLRLAGDPSAGDGAA     71 - 140
PRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALV    141 - 210
VGKPSPYMFECITENFSIDPARTLMVGDRLETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVP    211 - 280
HYYVESIADLTEGLED                                                          281 - 296
//

Text Mined References (18)

PMID Year Title
26324884 2015 Chronophin coordinates cell leading edge dynamics by controlling active cofilin levels.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23223568 2013 A novel Rac1 GAP splice variant relays poly-Ub accumulation signals to mediate Rac1 inactivation.
21897333 2011 Genes linked to energy metabolism and immunoregulatory mechanisms are associated with subcutaneous adipose tissue distribution in HIV-infected men.
21269460 2011 Initial characterization of the human central proteome.
19000834 2008 Chronophin mediates an ATP-sensing mechanism for cofilin dephosphorylation and neuronal cofilin-actin rod formation.
18510874 2008 Human brain pyridoxal-5'-phosphate phosphatase (PLPP):protein transduction of PEP-1-PLPP into PC12 cells.
18058037 2007 Structural genomics of protein phosphatases.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17500066 2007 Beta-arrestin-dependent regulation of the cofilin pathway downstream of protease-activated receptor-2.
16336786 2005 Human brain pyridoxal-5'-phosphate phosphatase: production and characterization of monoclonal antibodies.
15580268 2005 Chronophin, a novel HAD-type serine protein phosphatase, regulates cofilin-dependent actin dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14522954 2003 Human pyridoxal phosphatase. Molecular cloning, functional expression, and tissue distribution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8132548 1994 Identification of an essential cysteine residue in pyridoxal phosphatase from human erythrocytes.