Property Summary

NCBI Gene PubMed Count 145
PubMed Score 243.80
PubTator Score 418.29

Knowledge Summary

Patent

No data available

 GO Component (2)

Gene RIF (123)

PMID Text
26727107 Foxo1 and PDX1 are colocalized in fetal pancreatic islets, suggesting they function in parallel in beta cells.
26695692 The ERK-PDX-1 interaction in PANC-1 cells.
26345820 This study investigated the role of Pdx1 and its mechanism in differentiating induced pluripotent stem cells (iPSCs) into islet beta cells.
26252949 the human Pdx1 is highly effective in triggering human biliary tree stem cells differentiation toward functional beta-pancreatic cells.
26058934 The rs12255372 SNP of TCF7L2 and D76N of PDX-1 genes may confer susceptibility to T2DM in the population living in Mashhad, Iran.
25843046 we found that PDX1 binds and suppresses expression of endogenous liver genes. These findings rebrand PDX1 as a context-dependent transcriptional repressor and activator within the same cell type.
25839229 These results suggest that IFN-gamma induced beta-cell dysfunction is mediated through decreased nuclear localization of Pdx-1.
25817342 Introduction of the PDX1 gene makes cells acquire a functional insulin secretory capacity
25801033 physiological and pathophysiological conditions dynamically regulated Pdx1 binding to these Swi/Snf complexes in vivo
25454709 PDX-1mRNA is detectable in samples of pancreatic cancer. Its quantification may be helpful to improve the diagnosis of pancreatic cancer.
25287601 CONCLUSIONS: Our results demonstrate the use of in vitro-synthesized PDX1 messenger RNA to differentiate hUC-MSCs into islet-like cells and pave the way toward the development of reprogramming and directed-differentiation methods
25201603 These results indicate that PDX-1 mRNA may offer a promising approach to produce safe IPCs for clinical diabetes mellitus treatment.
24464100 A rare (0.20%) frameshift variant in PDX1, encoding p.Gly218Alafs*12, associates with high risk of type 2 diabetes (OR = 2.27, P = 7.3 x 10(-7)).
23950697 Performed fully atomistic Molecular Dynamics simulations both in crystal and aqueous environments in order to elucidate the nature of the difference in binding contacts between Pdx1 and DNA (PDB 2H1K) .
23863625 MAFA, MAFB, NKX6.1, and PDX1 activity provides a gauge of islet beta cell function, with loss of MAFA (and/or MAFB) representing an early indicator of beta cell inactivity
23853095 PASK phosphorylates and inactivates GSK3beta, thereby preventing PDX-1 serine phosphorylation and alleviating GSK3beta-mediated PDX-1 protein degradation in pancreatic beta-cells.
23796517 A molecular mechanism for differential Pdx1 affinity to elements from the insulin and iapp promoter sequences.
23775130 Pdx1 is a transcription factor required for the formation of endocrine pancreas that is inhibited during Coxsackievirus B4 infection of human pancreas ductal cells
23696946 Developed a liquid-phase, non-radioactive, sensitive and specific luciferase immunoprecipitation systems assay to detect pdx1 autoantibodies in human sera.
23331010 studies indicated p38 MAP kinase is a positive regulator of PDX-1 stability and p38 exerts its stabilizing effect on PDX-1 through a phosphorylation-dependent inhibition of PDX-1 ubiquitination.
23320570 recessive PDX1 mutations are a rare but important cause of isolated permanent neonatal diabetes in patients without pancreatic hypoplasia/agenesis
23147868 Pdx1 has a role in pancreatic differentiation in human amniotic fluid-derived stem cells
22905092 PDX-1 is a therapeutic target for both hormonal symptoms and tumor volume in models of pancreatic cancer, insulinoma and islet neoplasia
22761608 Combined transfection of the three transcriptional factors, PDX-1, NeuroD1, and MafA, causes differentiation of bone marrow mesenchymal stem cells into insulin-producing cells
22640736 PDX1 repression of FABP1, LCT, and SI suggests a role for PDX1 in patterning anterior intestinal development.
22594685 Up-regulation of Pdx1 is a feature of cholangiocarcinogenesis associated with chronic cholangitis.
22570331 data demonstrate epigenetic modifications of PDX-1 may reduce its expression in diabetic islets which may lead to impaired insulin expression and secretion; data further suggest hyperglycemia may be a factor behind increased DNA methylation and decreased expression of PDX-1
22322596 Analysis of cell death genes led to the identification of Noxa and Puma as direct targets of Pdx1
21909647 a significant relation of PDX1 and CDX2 expressions among phenotypic classification of gastric carcinomas reveals an idea about similar functions for PDX1 and CDX2 in the evolution of gastric carcinoma.
21739268 Gastrin-positive neuroendocrine tumors, whether of duodenal or pancreatic origin, frequently expressed PDX1 (17/18), ISL1 (14/18), and NGN3 (14/18).
21652712 Through multiple mechanisms, SREBP-1c, when induced in a lipotoxic state, repressed PDX-1 expression contributing to the inhibition of insulin expression and beta cell dysfunction.
21612404 PDX-1 plays an important role in the induction of CD44+/CD105+ human amniotic fluid cells (HuAFCs) into functional pancreatic beta-cell-like cells in vitro.
21278380 ATF2 interacts with beta-cell-enriched transcription factors, MafA, Pdx1, and beta2, and activates insulin gene transcription.
21228366 TFF1, TFF2, and PDX1 were expressed only in lobular endocervical glandular hyperplasia.
21108535 Data suggest that NKX6.1 activates immature pancreatic markers but not pancreatic hormone gene expression in human liver cells, and suggest a potential role for NKX6.1 in promoting PDX-1 reprogrammed maturation along a beta-cell-like lineage.
20962579 PDX1, important for the regulation of insulin metabolism regulation, was able to repress the TBX15 promoter in a methylation-dependent manner, which might, at least partially, explain the specific mRNA decrease of TBX15 observed in vIUGR placentas.
20811152 in adult mouse beta cells, Pcif1 limits Pdx1 protein accumulation and thus the expression of insulin and other gene targets important in the maintenance of beta cell mass and function.
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20668890 pdx-1 functions as a "pancreas-permitting gene".
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622005 Promoter hypermethylation and histone hypoacetylation contribute to pancreatic-duodenal homeobox 1 silencing in gastric cancer.
20621032 The genetic and clinical features of diabetic subjects in a 5-generation Michigan-Kentucky pedigree ascertained through a proband with pancreatic agenesis and homozygous for the IPF1 mutation Pro63fsx60 are reported.
20467340 Results indicate that beta-cell dysfunction during progression of CP correlates with the decrease in PDX-1 gene expression.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20381624 The full-length human PDX1 gene was cloned into Pichia pastoris. Analysis of culture medium from methanol-induced expression yeast clones showed that rPDX1 was secreted into the culture medium, had a molecular weight of 50kDa, and was glycosylated.
20353756 Advanced glycation end-products impair the expression and distribution of transcription factors PDX1 and FOXO1 involved in regulating insulin gene transcription.
20036830 Studies indicate that the constitutive expression of Pdx-1 enhances the differentiation of hESCs toward pancreatic endocrine and exocrine cell types.
20009086 We found a novel mutation in the pancreatic and duodenal homeobox 1 gene (PDX1, IPF1) in the two patients, which segregated with diabetes in the homozygous state
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910415 Retinoic acid induced expression of PDX1 in pancreatic progenitors.
19843526 MODY7 gene, KLF11, is a novel p300-dependent regulator of Pdx-1 (MODY4) transcription in pancreatic islet beta cells.
19833727 the PDX1 C terminus has a role in mediating the effects of glucose, which modulates PDX1 stability via the AKT-GSK3 axis
19755420 Data demonstrate that the GLP-1R agonist, exendin-4, significantly improves the efficiency of PDX-1-mediated transdifferentiation.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19515026 Genetic testing showed combination MODY2 (c.1019+18G >A) and MODY4 (c.226G>A) gene mutations
19277121 Retnoic acid signaling mediated by the early induction of RARbeta through AA/Wnt3a is required for PDX1 expression. Part of RA's activity is mediated by FGF signaling.
19228875 Observational study of gene-disease association. (HuGE Navigator)
19208834 Recapitulation of pancreatic neuroendocrine tumors in human multiple endocrine neoplasia type I syndrome via Pdx1-directed inactivation of Men1.
19077462 survival analysis revealed that Ptc expression in grade 2 and PDX-1 expression in grade 3 carcinomas are independent survival factors.
19056911 Biphasic induction of Pdx1 also drives differentiation of human embryonic stem cells into pancreatic beta-cells.
19056482 Observational study of gene-disease association. (HuGE Navigator)
18855980 Transcription factor PDX-1 in human colorectal adenocarcinoma: a potential tumor marker? Data argue for further evaluation of PDX-1 as a biomarker for colorectal cancer.
18811724 Observational study of gene-disease association. (HuGE Navigator)
18754323 PDX-1 expression did not correlate with biochemical recurrence of prostate cancer, but decreased with higher Gleason pattern (p<0.001) and in metastases vs primary prostate cancer (p<0.001).
18754095 Alterations of gastric PDX1 expression in Helicobacter pylori infection, incisural antralisation, and intestinal metaplasia.
18718916 PPARgamma regulates pdx-1 transcription in beta-cells
18671802 PDX1 is exclusively expressed in the cytoplasmic compartment in solid pseudopapillary tumours.
18665085 PDX-1 regulates cell proliferation and invasion in pancreatic cancer cells. Down-regulation of PDX-1 expression inhibits pancreatic cancer cell growth in vitro and in vivo.
18593849 concomitant expression of Pax6 and Pdx1 is important for glucose-dependent insulinotropic polypeptide expression
18522939 Significance of large Maf proteins to Pdx1 expression in beta cells, and in particular MafB during pancreatic development.
18508668 Under diabetic conditions, expression and/or activities of PDX-1 and MafA in beta-cells are reduced [REVIEW].
18506375 Observational study of gene-disease association. (HuGE Navigator)
18477649 PDX1 expression is lost in gastric cancers. Its effect on cell proliferation/apoptosis, migration and tumor formation in vitro and in vivo suggested that this protein functions as a putative tumor suppressor in gastric cancer.
18361919 Anomalous migration of Pdx-1 on SDS-PAGE does not result from post-translational modifications.
18060872 The addition of betacellulin and nicotinamide sustained PDX1 expression and induced beta-cell differentiation. C-peptide-a genuine marker of de novo insulin production-was identified in the differentiated cells.
17957487 The up-regulation of PDX-1 may be an important mechanism in the induction of the Ulcer-associated cell lineage in Crohn's disease.
17761145 Activin B is a potent inducer of Pdx1 as well as Shh in differentiating embryonic stem cell derived embryoid bodies
17705277 This study suggests a dual role for PDX-1 in liver: inducing hepatic dedifferentiation and activating the pancreatic lineage.
17592437 Meta-analysis of gene-disease association. (HuGE Navigator)
17592437 D76N IPF1 is not contributing to type 2 diabete in early-onset or late-onset cohorts in the currently present worldwide dataset (Meta-analysis)
17583748 possible relationship between PDX-1 and the state of islet proliferation, islet-to-ductal transdifferentiation, apoptosis, and the expression of SSTRs
17327436 A study evaluating the extent to which common variation in the six known maturity-onset diabetes of the young (MODY) genes, which cause a monogenic form of type 2 diabetes, is associated with type 2 diabetes is presented.
17226789 Human bone marrow-derived mesenchymal stem cells (hMSCs) could be induced to differentiate into functional insulin-producing cells by introduction of the pancreatic duodenal homeobox-1 (PDX-1).
17143557 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17131142 Ex vivo lentiviral-mediated PDX1 expression in isolated adult liver cells represents a potential model for type 1 diabetes mellitus therapy.
17126328 Interaction of endogenous PDX-1 and PCIF1 in MIN6 insulinoma cells, is demonstarted.
17003361 Observational study of gene-disease association. (HuGE Navigator)
17003361 InsCCG243 does not act in a dominant, highly penetrant fashion in African Americans and is not a significant risk factor for type 2 diabetes in this population.
16936193 pancreatic duodenal homeobox (PDX)-1 expression decreased with age in pancreatic tissue sections of humans. data provide a possible explanation for the increased incidence of type 2 diabetes at an older age
16894468 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16874866 The putative pancreatic stem cells expressed pdx-1 and nestin.
16873704 Observational study of gene-disease association. (HuGE Navigator)
16741735 Mutations in a pedigree reveals in a point mutation, increasing susceptibility to type 2 diabetes.
16675598 The overexpression of Pdx1 enhanced expression of pancreatic enriched genes, induction of insulin expression may require additional signals that are only present in vivo.
16407209 IPF1/PDX1 protein can be phosphorylated in vivo in pancreatic beta-cells; this phosphorylation marks the protein for degradation by the proteasome machinery.
16405074 PDX-1 proteins are rapidly internalized by lipid raft-dependent macropinocytosis in HeLa cells.
16390394 Analysis of both exons of the Ipf-1 coding sequence from the presented patient's genomic DNA did not identify a mutation.
16229747 Observational study of gene-disease association. (HuGE Navigator)
16229747 The common alleles of regulatory variants in the 5' enhancer and promoter regions of the IPF1 gene increase susceptibility to type 2 diabetes among African American individuals.
16141209 Pdx-1 plays a novel role in linking H3-Lys-4 dimethylation and pol II elongation to insulin transcription
16092045 the P33T IPF1 mutation may provide an increased susceptibility to the development of gestational diabetes and MODY4 in the Italy-6 pedigree
15993959 co-expression and functional synergism of these beta-cell enriched transactivators, MafA, Pdx1, and Beta2, are critical for establishing the beta-cell-specific and efficient expression of the insulin gene.
15896300 These data suggest that mechanism of transduction of PDX-1 protein is by endocytosis and subsequent release from the endosome homogeneously in cytoplasm and nuclei.
15754742 Observational study of gene-disease association. (HuGE Navigator)
15300214 Hepatic regeneration and enforced PDX-1 expression accelerate transdifferentiation in liver.
15277425 Observational study of gene-disease association. (HuGE Navigator)
15170499 Polymorphism D76N does not confer sussceptibility to type 2 diabettes.
15107297 Stable overexpression of pancreatic duodenal homeobox-1 results in repression of the endogenous human lactase-phlorizin hydrolase gene in differentiated Caco-2 cells
15047618 the effect of pdx-1 expression during in vitro differentiation of embryonic stem cells
15028719 PDX-1 is activated at a specific binding site in the human insulin gene
14764823 Observational study of gene-disease association. (HuGE Navigator)
14764823 E224K showed reduced transactivation activity. IPF1 mutations leading to synthesis of mutant protein may contribute to development of familial early-onset diabetes/maturity-onset diabetes of young in Indo-Trinidadians.
14631368 PDX-1 represents a candidate switch factor for glandular exocrine and endocrine transdifferentiation in chronic gastritis and that an impaired parietal cell differentiation might play a key role in disturbed gastric morphogenic processes.
12972592 Analysis of the regulatory region of the LRH-1 gene demonstrated the presence of three functional binding sites for PDX1.
12970316 insulin promoter factor 1 level is critical for human pancreas formation
12947327 Re-expression of PDX-1 may represent a return to a more de-differentiated state by more aggressive pancreatic cancers
12783165 Cell-specific expression of the glucagon gene can only occur when Pdx1 expression extinguishes from the early alpha cell precursor.
12124776 differentiation of a human pancreatic duct cell line into endocrine cells: involvement of PDX-1 and HNF3beta transcription factors
12052878 Conserved sequences in a tissue-specific regulatory region of the pdx-1 gene mediate transcription in Pancreatic beta cells
11834421 differentiation factor during embryogenesis and a regulator of islet cell physiology in mature islet cells
11772903 Observational study of gene-disease association. (HuGE Navigator)
11270685 Observational study of gene-disease association. (HuGE Navigator)
11022198 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEV      1 - 70
PPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYA     71 - 140
AEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRG    141 - 210
GGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQ    211 - 280
EPR                                                                       281 - 283
//

Text Mined References (146)

PMID Year Title
26727107 2016 FoxO1 Plays an Important Role in Regulating ?-Cell Compensation for Insulin Resistance in Male Mice.
26695692 2016 Metformin Restrains Pancreatic Duodenal Homeobox-1 (PDX-1) Function by Inhibiting ERK Signaling in Pancreatic Ductal Adenocarcinoma.
26345820 2015 Pdxl and its role in activating Ngn3 and Pax6 to induce differentiation of iPSCs into islet ? cells.
26252949 2015 Adult Human Biliary Tree Stem Cells Differentiate to ?-Pancreatic Islet Cells by Treatment with a Recombinant Human Pdx1 Peptide.
26058934 2015 Association of rs12255372 (TCF7L2) and D76N (PDX-1) Polymorphisms with Type 2 Diabetes in a Population Living in Northeast Iran.
25843046 2015 PDX1 binds and represses hepatic genes to ensure robust pancreatic commitment in differentiating human embryonic stem cells.
25839229 2015 Interferon-? Decreases Nuclear Localization of Pdx-1 and Triggers ?-Cell Dysfunction in Chronic Pancreatitis.
25817342 2015 Forced expression of PDX-1 gene makes hepatoma cells to acquire glucose-responsive insulin secretion while maintaining hepatic characteristic.
25801033 2015 Dynamic recruitment of functionally distinct Swi/Snf chromatin remodeling complexes modulates Pdx1 activity in islet ? cells.
25454709 2015 PDX-1 mRNA expression in endoscopic ultrasound-guided fine needle cytoaspirate: perspectives in the diagnosis of pancreatic cancer.
25287601 2014 Reprogramming human umbilical cord mesenchymal stromal cells to islet-like cells with the use of in vitro-synthesized pancreatic-duodenal homebox 1 messenger RNA.
25201603 2014 Improved differentiation of umbilical cord blood-derived mesenchymal stem cells into insulin-producing cells by PDX-1 mRNA transfection.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24567802 2014 Identification and differentiation of PDX1 ?-cell progenitors within the human pancreatic epithelium.
24464100 2014 Identification of low-frequency and rare sequence variants associated with elevated or reduced risk of type 2 diabetes.
23950697 2013 Binding polymorphism in the DNA bound state of the Pdx1 homeodomain.
23863625 2013 Inactivation of specific ? cell transcription factors in type 2 diabetes.
23853095 2013 Per-Arnt-Sim kinase regulates pancreatic duodenal homeobox-1 protein stability via phosphorylation of glycogen synthase kinase 3? in pancreatic ?-cells.
23796517 2013 Thermodynamic and structural determinants of differential Pdx1 binding to elements from the insulin and IAPP promoters.
23775130 2013 Coxsackievirus B4 can infect human pancreas ductal cells and persist in ductal-like cell cultures which results in inhibition of Pdx1 expression and disturbed formation of islet-like cell aggregates.
23696946 2013 Novel detection of pancreatic and duodenal homeobox 1 autoantibodies (PAA) in human sera using luciferase immunoprecipitation systems (LIPS) assay.
23331010 2013 p38 MAP kinase interacts with and stabilizes pancreatic and duodenal homeobox-1.
23320570 2013 Biallelic PDX1 (insulin promoter factor 1) mutations causing neonatal diabetes without exocrine pancreatic insufficiency.
23147868 2015 Pdx1 and controlled culture conditions induced differentiation of human amniotic fluid-derived stem cells to insulin-producing clusters.
22905092 2012 PDX-1 is a therapeutic target for pancreatic cancer, insulinoma and islet neoplasia using a novel RNA interference platform.
22761608 2012 Combined transfection of the three transcriptional factors, PDX-1, NeuroD1, and MafA, causes differentiation of bone marrow mesenchymal stem cells into insulin-producing cells.
22640736 2012 PDX1 regulation of FABP1 and novel target genes in human intestinal epithelial Caco-2 cells.
22594685 2012 Bile duct expression of pancreatic and duodenal homeobox 1 in perihilar cholangiocarcinogenesis.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22570331 2012 Increased DNA methylation and decreased expression of PDX-1 in pancreatic islets from patients with type 2 diabetes.
22322596 2012 Research resource: the pdx1 cistrome of pancreatic islets.
21909647 2011 The relationship among PDX1, CDX2, and mucin profiles in gastric carcinomas; correlations with clinicopathologic parameters.
21739268 2011 Hormonally defined pancreatic and duodenal neuroendocrine tumors differ in their transcription factor signatures: expression of ISL1, PDX1, NGN3, and CDX2.
21652712 2011 Suppression of the pancreatic duodenal homeodomain transcription factor-1 (Pdx-1) promoter by sterol regulatory element-binding protein-1c (SREBP-1c).
21612404 2011 Induction of pancreatic ?-cell-like cells from CD44+/CD105+ human amniotic fluids via epigenetic regulation of the pancreatic and duodenal homeobox factor 1 promoter.
21278380 2011 ATF2 interacts with beta-cell-enriched transcription factors, MafA, Pdx1, and beta2, and activates insulin gene transcription.
21228366 2011 Aberrant expression of TFF1, TFF2, and PDX1 and their diagnostic value in lobular endocervical glandular hyperplasia.
21108535 2010 NKX6.1 promotes PDX-1-induced liver to pancreatic ?-cells reprogramming.
20962579 2011 Combination of promoter hypomethylation and PDX1 overexpression leads to TBX15 decrease in vascular IUGR placentas.
20811152 2010 Pcif1 modulates Pdx1 protein stability and pancreatic ? cell function and survival in mice.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20668890 2011 Genetic lineage tracing, a powerful tool to investigate the embryonic organogenesis and adult organ maintenance of the pancreas.
20637728 2010 Pancreatic and duodenal homeobox 1 (PDX1) phosphorylation at serine-269 is HIPK2-dependent and affects PDX1 subnuclear localization.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20622005 2010 Promoter hypermethylation and histone hypoacetylation contribute to pancreatic-duodenal homeobox 1 silencing in gastric cancer.
20621032 2010 Obesity and hyperinsulinemia in a family with pancreatic agenesis and MODY caused by the IPF1 mutation Pro63fsX60.
20467340 2010 Reduced expression of PDX-1 is associated with decreased beta cell function in chronic pancreatitis.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20381624 2010 Expression, purification, and characterization of recombinant human pancreatic duodenal homeobox-1 protein in Pichia pastoris.
20353756 2010 Advanced glycation end-products affect transcription factors regulating insulin gene expression.
20036830 2010 Stem cells as a therapeutic target for diabetes.
20009086 2010 A novel hypomorphic PDX1 mutation responsible for permanent neonatal diabetes with subclinical exocrine deficiency.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910415 2010 Generation of homogeneous PDX1(+) pancreatic progenitors from human ES cell-derived endoderm cells.
19843526 2009 MODY7 gene, KLF11, is a novel p300-dependent regulator of Pdx-1 (MODY4) transcription in pancreatic islet beta cells.
19833727 2010 Glucose regulates steady-state levels of PDX1 via the reciprocal actions of GSK3 and AKT kinases.
19755420 2009 Exendin-4 promotes liver cell proliferation and enhances the PDX-1-induced liver to pancreas transdifferentiation process.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19515026 2009 An infant with combination gene mutations for Monogenic Diabetes of Youth (MODY) 2 and 4, presenting with Diabetes Mellitus Requiring Insulin (DMRI) at 8 months of age.
19277121 2009 FGF4 and retinoic acid direct differentiation of hESCs into PDX1-expressing foregut endoderm in a time- and concentration-dependent manner.
19228875 2009 A-beta-subtype of ketosis-prone diabetes is not predominantly a monogenic diabetic syndrome.
19208834 2009 Recapitulation of pancreatic neuroendocrine tumors in human multiple endocrine neoplasia type I syndrome via Pdx1-directed inactivation of Men1.
19077462 2009 The expression pattern of PDX-1, SHH, Patched and Gli-1 is associated with pathological and clinical features in human pancreatic cancer.
19056911 2009 Biphasic induction of Pdx1 in mouse and human embryonic stem cells can mimic development of pancreatic beta-cells.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18855980 2008 Transcription factor PDX-1 in human colorectal adenocarcinoma: a potential tumor marker?
18811724 2009 Mutations of maturity-onset diabetes of the young (MODY) genes in Thais with early-onset type 2 diabetes mellitus.
18754323 2008 Expression of PDX-1 in prostate cancer, prostatic intraepithelial neoplasia and benign prostatic tissue.
18754095 2009 Alterations of gastric homeoprotein expression in Helicobacter pylori infection, incisural antralisation, and intestinal metaplasia.
18718916 2008 In vivo and in vitro studies of a functional peroxisome proliferator-activated receptor gamma response element in the mouse pdx-1 promoter.
18671802 2008 Transcription factors involved in pancreas development are expressed in paediatric solid pseudopapillary tumours.
18665085 2008 PDX-1 acts as a potential molecular target for treatment of human pancreatic cancer.
18593849 2008 Pax6 and Pdx1 are required for production of glucose-dependent insulinotropic polypeptide in proglucagon-expressing L cells.
18522939 2008 MafA and MafB regulate Pdx1 transcription through the Area II control region in pancreatic beta cells.
18508668 2008 PDX-1 functions as a master factor in the pancreas.
18506375 2008 Association of genetic variants with atherothrombotic cerebral infarction in Japanese individuals with metabolic syndrome.
18477649 2008 Pancreatic duodenal homeobox-1 (PDX1) functions as a tumor suppressor in gastric cancer.
18361919 2008 The 45-kDa form of Pdx-1 does not result from post-translational modifications.
18060872 2008 Betacellulin and nicotinamide sustain PDX1 expression and induce pancreatic beta-cell differentiation in human embryonic stem cells.
17957487 2008 Altered expression of CDX-2, PDX-1 and mucin core proteins in "Ulcer-associated cell lineage (UACL)" in Crohn's disease.
17941991 2007 Induction of insulin secretion in engineered liver cells by nitric oxide.
17761145 2007 Activin B mediated induction of Pdx1 in human embryonic stem cell derived embryoid bodies.
17705277 2007 Pancreatic and duodenal homeobox gene 1 induces hepatic dedifferentiation by suppressing the expression of CCAAT/enhancer-binding protein beta.
17592437 2007 Meta-analysis of the IPF1 D76N polymorphism in a worldwide type 2 diabetes population.
17583748 2008 PDX-1 expression is associated with islet proliferation in vitro and in vivo.
17327436 2007 Evaluation of common variants in the six known maturity-onset diabetes of the young (MODY) genes for association with type 2 diabetes.
17226789 2007 Generation of insulin-producing cells from PDX-1 gene-modified human mesenchymal stem cells.
17143557 2007 Association of gene polymorphisms with myocardial infarction in individuals with or without conventional coronary risk factors.
17131142 2007 Adult rat liver cells transdifferentiated with lentiviral IPF1 vectors reverse diabetes in mice: an ex vivo gene therapy approach.
17126328 2006 Two conserved domains in PCIF1 mediate interaction with pancreatic transcription factor PDX-1.
17003361 2006 Role of a proline insertion in the insulin promoter factor 1 (IPF1) gene in African Americans with type 2 diabetes.
16936193 2006 Aging correlates with decreased beta-cell proliferative capacity and enhanced sensitivity to apoptosis: a potential role for Fas and pancreatic duodenal homeobox-1.
16894468 2006 Assessment of genetic risk for myocardial infarction.
16874866 2006 Characterization of pancreatic stem cells derived from adult human pancreas ducts by fluorescence activated cell sorting.
16873704 2006 Association studies of variants in the genes involved in pancreatic beta-cell function in type 2 diabetes in Japanese subjects.
16741735 2006 A newly identified mutation in an IPF1 binding site of the insulin gene promoter may predispose to type 2 diabetes mellitus.
16675598 2006 The effect of overexpression of Pdx1 and Foxa2 on the differentiation of human embryonic stem cells into pancreatic cells.
16407209 2006 Phosphorylation marks IPF1/PDX1 protein for degradation by glycogen synthase kinase 3-dependent mechanisms.
16405074 2005 PDX-1 protein is internalized by lipid raft-dependent macropinocytosis.
16390394 2005 Unusual case of neonatal diabetes mellitus due to congenital pancreas agenesis.
16229747 2005 Insulin Promoter Factor 1 variation is associated with type 2 diabetes in African Americans.
16141209 2005 Pdx-1 links histone H3-Lys-4 methylation to RNA polymerase II elongation during activation of insulin transcription.
16092045 2005 IPF-1/MODY4 gene missense mutation in an Italian family with type 2 and gestational diabetes.
15993959 2005 Synergistic activation of the insulin gene promoter by the beta-cell enriched transcription factors MafA, Beta2, and Pdx1.
15896300 2005 Mechanism of PDX-1 protein transduction.
15839736 2005 Differentiation of insulin-producing cells from human neural progenitor cells.
15754742 2004 Missense mutations in the human insulin promoter factor-1 gene are not a common cause of type 2 diabetes mellitus in Taiwan.
15665000 2005 The islet beta cell-enriched MafA activator is a key regulator of insulin gene transcription.
15664999 2005 Oxidative stress-mediated, post-translational loss of MafA protein as a contributing mechanism to loss of insulin gene expression in glucotoxic beta cells.
15300214 2004 Hepatic regeneration and enforced PDX-1 expression accelerate transdifferentiation in liver.
15277425 2004 Does the aspartic acid to asparagine substitution at position 76 in the pancreas duodenum homeobox gene (PDX1) cause late-onset type 2 diabetes?
15170499 2004 Role of the D76N polymorphism of insulin promoter factor-1 in predisposing to Type 2 diabetes.
15121856 2004 Identification of PCIF1, a POZ domain protein that inhibits PDX-1 (MODY4) transcriptional activity.
15107297 2004 Transcriptional regulation of the lactase-phlorizin hydrolase promoter by PDX-1.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15047618 2004 Regulated expression of pdx-1 promotes in vitro differentiation of insulin-producing cells from embryonic stem cells.
15028719 2004 Identification of a novel PDX-1 binding site in the human insulin gene enhancer.
14764823 2004 Insulin promoter factor-1 mutations and diabetes in Trinidad: identification of a novel diabetes-associated mutation (E224K) in an Indo-Trinidadian family.
14631368 2004 Gastric PDX-1 expression in pancreatic metaplasia and endocrine cell hyperplasia in atrophic corpus gastritis.
12972592 2003 Pancreatic-duodenal homeobox 1 regulates expression of liver receptor homolog 1 during pancreas development.
12970316 2003 Agenesis of human pancreas due to decreased half-life of insulin promoter factor 1.
12947327 2003 Increased PDX-1 expression is associated with outcome in patients with pancreatic cancer.
12783165 2003 Ectopic expression of the beta-cell specific transcription factor Pdx1 inhibits glucagon gene transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12124776 2002 Exendin-4 differentiation of a human pancreatic duct cell line into endocrine cells: involvement of PDX-1 and HNF3beta transcription factors.
11834421 2002 Pancreas duodenum homeobox-1 regulates pancreas development during embryogenesis and islet cell function in adulthood.
11772903 2002 Screening for MODY mutations, GAD antibodies, and type 1 diabetes--associated HLA genotypes in women with gestational diabetes mellitus.
11279116 2001 DNA binding and transcriptional activation by a PDX1.PBX1b.MEIS2b trimer and cooperation with a pancreas-specific basic helix-loop-helix complex.
11270685 2001 Functional consequences of mutations in the MODY4 gene (IPF1) and coexistence with MODY3 mutations.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11022198 2000 Mutations in the insulin promoter factor-1 gene in late-onset type 2 diabetes mellitus.
10751390 2000 Pancreatic homeodomain transcription factor IDX1/IPF1 expressed in developing brain regulates somatostatin gene transcription in embryonic neural cells.
10636926 2000 Transcription factor BETA2 acts cooperatively with E2A and PDX1 to activate the insulin gene promoter.
10545531 1999 Defective mutations in the insulin promoter factor-1 (IPF-1) gene in late-onset type 2 diabetes mellitus.
10545530 1999 Missense mutations in the insulin promoter factor-1 gene predispose to type 2 diabetes.
9252422 1997 The p38/reactivating kinase mitogen-activated protein kinase cascade mediates the activation of the transcription factor insulin upstream factor 1 and insulin gene transcription by high glucose in pancreatic beta-cells.
9115263 1997 Identification of cis- and trans-active factors regulating human islet amyloid polypeptide gene expression in pancreatic beta-cells.
9111329 1997 Hormonal regulation of an islet-specific enhancer in the pancreatic homeobox gene STF-1.
8988180 1997 Pancreatic agenesis attributable to a single nucleotide deletion in the human IPF1 gene coding sequence.
8986763 1996 Purification of the beta-cell glucose-sensitive factor that transactivates the insulin gene differentially in normal and transformed islet cells.
8954967 1996 Involvement of the homeodomain-containing transcription factor PDX-1 in islet amyloid polypeptide gene transcription.
8923459 1996 Transcriptional activation of the GLUT2 gene by the IPF-1/STF-1/IDX-1 homeobox factor.
8635654 1996 Isolation, characterization, and chromosomal mapping of the human insulin promoter factor 1 (IPF-1) gene.
7590740 1995 Localization of human homeodomain transcription factor insulin promoter factor 1 (IPF1) to chromosome band 13q12.1.
7505393 1993 Characterization of somatostatin transactivating factor-1, a novel homeobox factor that stimulates somatostatin expression in pancreatic islet cells.