Property Summary

NCBI Gene PubMed Count 22
PubMed Score 48.41
PubTator Score 23.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.628 7.7e-06
posterior fossa group B ependymoma 1.300 2.4e-04
adrenocortical carcinoma -1.613 4.9e-06
tuberculosis 1.500 3.1e-07
pancreatic ductal adenocarcinoma liver m... -1.111 6.3e-03
intraductal papillary-mucinous adenoma (... 1.100 1.9e-03
group 3 medulloblastoma 1.100 8.5e-04
ovarian cancer 1.200 6.2e-04

Protein-protein Interaction (1)

Gene RIF (14)

PMID Text
25780306 Decreased PDSS2 expression is an unfavorable prognostic factor for hepatocellular carcinoma, and PDSS2 has potent anticancer activity in HCC tissues and HepG2 cells.
25330808 PDSS2 encodes a putative tumor suppressor, and its expression is regulated by hypermethylation of its promoter in gastric cancer cells.
25189544 Decreased PDSS2 mRNA levels were detected in HCC tissues of 56 patients, correlated with shorter disease-specific survival, and was identified as an independent prognostic factor
24608273 PDSS2 has tumor-suppressing activity in human lung cancer cells by enhancing apoptosis and inhibiting tumorigenic capacity.
23926186 Human PDSS2 polymorphisms are associated with podocyte diseases. A deficiency of coenzyme Q10 is manifested in lymphoblastoid cell lines derived from focal segmental glomerulosclerosis patients.
23312889 Loss of PDSS2 expression is associated with non-small cell lung cancer.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20507940 Observational study of gene-disease association. (HuGE Navigator)
20051244 Data show that expression of either dlp1 or dps1 recovered the thermo-sensitive growth of an E. coli ispB(R321A) mutant and restored IspB activity and production of Coenzyme Q-8.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19209031 Expression of PDSS2 is downregulated in human gastric cancer. PDSS2 may be a potent gastric cancer growth suppressor in vitro acting through apoptosis pathways.
18978678 Observational study of gene-disease association. (HuGE Navigator)
16262699 murine and human solanesyl and decaprenyl diphosphate synthases are heterotetramers composed of newly characterized hDPS1 (mSPS1) and hDLP1 (mDLP1).

AA Sequence

MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLR      1 - 70
CLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSG     71 - 140
IYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTK    141 - 210
VVELLASALMDLVQGVYHENSTSKESYITDDIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMA    211 - 280
FQYGKHMAMSHKINSDVQPFIKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGEAQEKGRLDYAKLRE    281 - 350
RIKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS                         351 - 399
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25780306 2015 Decaprenyl diphosphate synthase subunit 2 as a prognosis factor in hepatocellular carcinoma.
25330808 2014 Decreased expression of prenyl diphosphate synthase subunit 2 correlates with reduced survival of patients with gastric cancer.
25189544 2014 Clinical utility of PDSS2 expression to stratify patients at risk for recurrence of hepatocellular carcinoma.
24608273 2014 The tumor-suppressing activity of the prenyl diphosphate synthase subunit 2 gene in lung cancer cells.
23926186 2013 Focal segmental glomerulosclerosis is associated with a PDSS2 haplotype and, independently, with a decreased content of coenzyme Q10.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23312889 2013 Decrease of PDSS2 expression, a novel tumor suppressor, in non-small cell lung cancer.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20507940 2010 Genotype-phenotype correlations in non-Finnish congenital nephrotic syndrome.
20051244 2010 A subunit of decaprenyl diphosphate synthase stabilizes octaprenyl diphosphate synthase in Escherichia coli by forming a high-molecular weight complex.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19209031 2009 Anticancer activity of PDSS2, prenyl diphosphate synthase, subunit 2, in gastric cancer tissue and the SGC7901 cell line.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17855635 2007 COQ2 nephropathy: a newly described inherited mitochondriopathy with primary renal involvement.
17186472 2006 Leigh syndrome with nephropathy and CoQ10 deficiency due to decaprenyl diphosphate synthase subunit 2 (PDSS2) mutations.
16262699 2005 Characterization of solanesyl and decaprenyl diphosphate synthases in mice and humans.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.