Property Summary

NCBI Gene PubMed Count 24
PubMed Score 51.09
PubTator Score 9.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.500 1.9e-02
Waldenstrons macroglobulinemia 1.038 1.6e-02
psoriasis 1.800 1.7e-04
sonic hedgehog group medulloblastoma 1.500 1.9e-05
glioblastoma 1.100 1.2e-02
atypical teratoid/rhabdoid tumor 1.400 6.1e-07
medulloblastoma, large-cell 1.100 1.6e-04
spina bifida -1.740 3.6e-02

Gene RIF (7)

PMID Text
26051894 By interacting with a unique domain of Esco1, Pds5 recruits Esco1 to chromatin-bound cohesin complexes to form cohesion.
21865657 The data show a downregulation of proliferation-associated host gene PDS5A and suggest a role of PDS5A in HIV-1-induced cellular pathogenesis but not viral replication.
21069257 Data show that the siRNA-mediated knockdown of Pds5A affects sister chromatid cohesion but does not influence mitotic checkpoint function or the proliferation and survival of glioblastoma multiforme cells.
20359100 Observational study of gene-disease association. (HuGE Navigator)
19454010 Interaction of HIV-1 Tat with PDS5A in T-cells is identified by a proteomic strategy based on affinity chromatography coupled with mass spectrometry
17846787 SCC-112 improve cell proliferation and contributes to tumorigenesis by interacting with p63 and promoting cell cycling.
15019998 Findings suggest that the SCC-112 gene expression is likely to be associated with normal cell growth and proliferation.

AA Sequence

MDFTAQPKPATALCGVVSADGKIAYPPGVKEITDKITTDEMIKRLKMVVKTFMDMDQDSEDEKQQYLPLA      1 - 70
LHLASEFFLRNPNKDVRLLVACCLADIFRIYAPEAPYTSHDKLKDIFLFITRQLKGLEDTKSPQFNRYFY     71 - 140
LLENLAWVKSYNICFELEDCNEIFIQLFRTLFSVINNSHNKKVQMHMLDLMSSIIMEGDGVTQELLDSIL    141 - 210
INLIPAHKNLNKQSFDLAKVLLKRTVQTIEACIANFFNQVLVLGRSSVSDLSEHVFDLIQELFAIDPHLL    211 - 280
LSVMPQLEFKLKSNDGEERLAVVRLLAKLFGSKDSDLATQNRPLWQCFLGRFNDIHVPVRLESVKFASHC    281 - 350
LMNHPDLAKDLTEYLKVRSHDPEEAIRHDVIVTIITAAKRDLALVNDQLLGFVRERTLDKRWRVRKEAMM    351 - 420
GLAQLYKKYCLHGEAGKEAAEKVSWIKDKLLHIYYQNSIDDKLLVEKIFAQYLVPHNLETEERMKCLYYL    421 - 490
YASLDPNAVKALNEMWKCQNMLRSHVRELLDLHKQPTSEANCSAMFGKLMTIAKNLPDPGKAQDFVKKFN    491 - 560
QVLGDDEKLRSQLELLISPTCSCKQADICVREIARKLANPKQPTNPFLEMVKFLLERIAPVHIDSEAISA    561 - 630
LVKLMNKSIEGTADDEEEGVSPDTAIRSGLELLKVLSFTHPTSFHSAETYESLLQCLRMEDDKVAEAAIQ    631 - 700
IFRNTGHKIETDLPQIRSTLIPILHQKAKRGTPHQAKQAVHCIHAIFTNKEVQLAQIFEPLSRSLNADVP    701 - 770
EQLITPLVSLGHISMLAPDQFASPMKSVVANFIVKDLLMNDRSTGEKNGKLWSPDEEVSPEVLAKVQAIK    771 - 840
LLVRWLLGMKNNQSKSANSTLRLLSAMLVSEGDLTEQKRISKSDMSRLRLAAGSAIMKLAQEPCYHEIIT    841 - 910
PEQFQLCALVINDECYQVRQIFAQKLHKALVKLLLPLEYMAIFALCAKDPVKERRAHARQCLLKNISIRR    911 - 980
EYIKQNPMATEKLLSLLPEYVVPYMIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFM    981 - 1050
KKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKS   1051 - 1120
YISEETRVLLLTGKPKPAGVLGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAA   1121 - 1190
ETGVSENEENPVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDES   1191 - 1260
GPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQDLAKKAAPAE   1261 - 1330
RQIDLQR                                                                  1331 - 1337
//

Text Mined References (39)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26051894 2015 Esco1 Acetylates Cohesin via a Mechanism Different from That of Esco2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141881 2013 Pds5B is required for cohesion establishment and Aurora B accumulation at centromeres.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21865657 2012 HIV-1 infection suppresses expression of host cell cycle-associated gene PDS5A.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21111234 2010 Sororin mediates sister chromatid cohesion by antagonizing Wapl.
21069257 2011 The cohesin-interacting protein, precocious dissociation of sisters 5A/sister chromatid cohesion protein 112, is up-regulated in human astrocytic tumors.
20359100 2009 [Analysis of deafness gene mutations by gene chip and its clinical significance].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19907496 2009 Cohesin acetylation speeds the replication fork.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17846787 2008 SCC-112 gene is involved in tumor progression and promotes the cell proliferation in G2/M phase.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17349791 2007 Sororin is required for stable binding of cohesin to chromatin and for sister chromatid cohesion in interphase.
17113138 2006 Wapl controls the dynamic association of cohesin with chromatin.
17112726 2006 Human Wapl is a cohesin-binding protein that promotes sister-chromatid resolution in mitotic prophase.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16682347 2006 Human Scc4 is required for cohesin binding to chromatin, sister-chromatid cohesion, and mitotic progression.
15855230 2005 Functional contribution of Pds5 to cohesin-mediated cohesion in human cells and Xenopus egg extracts.
15837422 2005 Sororin, a substrate of the anaphase-promoting complex, is required for sister chromatid cohesion in vertebrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15019998 2004 SCC-112, a novel cell cycle-regulated molecule, exhibits reduced expression in human renal carcinomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11590136 2001 A potential role for human cohesin in mitotic spindle aster assembly.
11076961 2000 Characterization of vertebrate cohesin complexes and their regulation in prophase.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.