Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.96
PubTator Score 5.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Liver neoplasms 108
Disease Target Count P-value
adrenocortical carcinoma 1427 5.0e-04
acute myeloid leukemia 785 4.5e-02

Expression

  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma 1.096 5.0e-04
acute myeloid leukemia 1.200 4.5e-02

Synonym

Accession Q9NUG6 B2R511 Q96GP3 Q9BUW8
Symbols PDRG
C20orf126

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
25706919 PDRG1 was significantly increased in tumors low of miR-214.
21193842 PDRG1 expression is increased in multiple human malignancies suggesting it to be a high-value novel tumor marker that could play a role in cancer development and/or progression.
19450687 Is part of an RNA polymerase II-associated complex with possible chaperone activity.
14562055 Cloning and characterization of a novel gene PDRG that is differentially regulated by p53 and ultraviolet radiation

AA Sequence

MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPH      1 - 70
PETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG            71 - 133
//

Text Mined References (11)

PMID Year Title
25706919 2015 MicroRNA-214 suppresses oncogenesis and exerts impact on prognosis by targeting PDRG1 in bladder cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21193842 2011 PDRG1, a novel tumor marker for multiple malignancies that is selectively regulated by genotoxic stress.
19450687 2009 High-resolution mapping of the protein interaction network for the human transcription machinery and affinity purification of RNA polymerase II-associated complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14562055 2003 Cloning and characterization of a novel gene PDRG that is differentially regulated by p53 and ultraviolet radiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.