Property Summary

Ligand Count 270
NCBI Gene PubMed Count 194
PubMed Score 204.92
PubTator Score 53.11

Knowledge Summary

Patent (86,102)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.400 7.1e-06
astrocytic glioma -1.400 1.7e-02
Astrocytoma, Pilocytic -1.500 1.1e-03
atypical teratoid / rhabdoid tumor -2.400 2.5e-06
ependymoma -1.600 3.6e-02
glioblastoma -1.500 1.9e-04
group 4 medulloblastoma -1.400 1.2e-02
medulloblastoma, large-cell -2.600 1.5e-05
osteosarcoma -1.084 5.1e-06
ovarian cancer -1.200 5.0e-06
primitive neuroectodermal tumor -1.200 1.6e-02
subependymal giant cell astrocytoma -1.097 2.1e-02

Protein-protein Interaction (6)

PDB (68)

Gene RIF (109)

AA Sequence

MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRPGAGSLQHAQP      1 - 70
PPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHP     71 - 140
FFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPEN    141 - 210
ILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLP    211 - 280
PFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENL    281 - 350
HQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD    351 - 420
SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPV    421 - 490
NKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ        491 - 556
//

Text Mined References (205)

PMID Year Title