Tbio | PDZ and LIM domain protein 7 |
May function as a scaffold on which the coordinated assembly of proteins can occur. May play a role as an adapter that, via its PDZ domain, localizes LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Involved in both of the two fundamental mechanisms of bone formation, direct bone formation (e.g. embryonic flat bones mandible and cranium), and endochondral bone formation (e.g. embryonic long bone development). Plays a role during fracture repair. Involved in BMP6 signaling pathway (By similarity).
The protein encoded by this gene is representative of a family of proteins composed of conserved PDZ and LIM domains. LIM domains are proposed to function in protein-protein recognition in a variety of contexts including gene transcription and development and in cytoskeletal interaction. The LIM domains of this protein bind to protein kinases, whereas the PDZ domain binds to actin filaments. The gene product is involved in the assembly of an actin filament-associated complex essential for transmission of ret/ptc2 mitogenic signaling. The biological function is likely to be that of an adapter, with the PDZ domain localizing the LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
The protein encoded by this gene is representative of a family of proteins composed of conserved PDZ and LIM domains. LIM domains are proposed to function in protein-protein recognition in a variety of contexts including gene transcription and development and in cytoskeletal interaction. The LIM domains of this protein bind to protein kinases, whereas the PDZ domain binds to actin filaments. The gene product is involved in the assembly of an actin filament-associated complex essential for transmission of ret/ptc2 mitogenic signaling. The biological function is likely to be that of an adapter, with the PDZ domain localizing the LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
atypical teratoid / rhabdoid tumor | 5112 | 8.6e-06 |
osteosarcoma | 7950 | 2.0e-04 |
psoriasis | 6694 | 1.2e-03 |
COPD | 118 | 2.1e-03 |
colon cancer | 1478 | 2.4e-03 |
interstitial lung disease | 298 | 4.5e-03 |
Polycystic ovary syndrome | 360 | 5.3e-03 |
primary pancreatic ductal adenocarcinoma | 1109 | 6.5e-03 |
adult high grade glioma | 3801 | 7.3e-03 |
pancreatic cancer | 2398 | 7.4e-03 |
glioblastoma | 5792 | 7.9e-03 |
chronic rhinosinusitis | 512 | 1.4e-02 |
dermatomyositis | 966 | 1.7e-02 |
Rheumatoid arthritis | 1191 | 2.0e-02 |
gastric carcinoma | 807 | 3.0e-02 |
Gaucher disease type 3 | 67 | 3.6e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Lymphoma | 81 | 4.718 | 2.4 |
Nasopharynx carcinoma | 18 | 3.896 | 1.9 |
Pleural empyema | 12 | 3.678 | 1.8 |
Dental pulp calcification | 5 | 3.618 | 1.8 |
Lymphoproliferative syndrome | 58 | 3.586 | 1.8 |
lymphoepithelioma-like carcinoma | 1 | 3.46 | 1.7 |
Disease | log2 FC | p |
---|---|---|
adult high grade glioma | 1.100 | 7.3e-03 |
atypical teratoid / rhabdoid tumor | 2.200 | 8.6e-06 |
chronic rhinosinusitis | 1.069 | 1.4e-02 |
colon cancer | -1.500 | 2.4e-03 |
COPD | -1.300 | 2.1e-03 |
dermatomyositis | -1.200 | 1.7e-02 |
gastric carcinoma | 1.700 | 3.0e-02 |
Gaucher disease type 3 | 1.100 | 3.6e-02 |
glioblastoma | 1.600 | 7.9e-03 |
interstitial lung disease | 1.100 | 4.5e-03 |
osteosarcoma | -1.047 | 2.0e-04 |
pancreatic cancer | 1.800 | 7.4e-03 |
Polycystic ovary syndrome | -1.011 | 5.3e-03 |
primary pancreatic ductal adenocarcinoma | 1.608 | 6.5e-03 |
psoriasis | -1.200 | 1.2e-03 |
Rheumatoid arthritis | -1.700 | 2.0e-02 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid EggNOG | ||
Inparanoid OMA EggNOG |
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNKI 1 - 70 RACGERLSLGLSRAQPVQSKPQKASAPAADPPRYTFAPSVSLNKTARPFGAPPPADSAPQQNGQPLRPLV 71 - 140 PDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPW 141 - 210 PGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATPTPLQSRTSIVQAAAGGVPGGGSNNGKTP 211 - 280 VCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITG 281 - 350 EIMHALKMTWHVHCFTCAACKTPIRNRAFYMEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFS 351 - 420 WHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSHV 421 - 457 //