Property Summary

NCBI Gene PubMed Count 43
PubMed Score 256.94
PubTator Score 1108.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.100 7.3e-03
atypical teratoid / rhabdoid tumor 2.200 8.6e-06
chronic rhinosinusitis 1.069 1.4e-02
colon cancer -1.500 2.4e-03
COPD -1.300 2.1e-03
dermatomyositis -1.200 1.7e-02
gastric carcinoma 1.700 3.0e-02
Gaucher disease type 3 1.100 3.6e-02
glioblastoma 1.600 7.9e-03
interstitial lung disease 1.100 4.5e-03
osteosarcoma -1.047 2.0e-04
pancreatic cancer 1.800 7.4e-03
Polycystic ovary syndrome -1.011 5.3e-03
primary pancreatic ductal adenocarcinoma 1.608 6.5e-03
psoriasis -1.200 1.2e-03
Rheumatoid arthritis -1.700 2.0e-02

Protein-protein Interaction (8)

Gene RIF (27)

AA Sequence

MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNKI      1 - 70
RACGERLSLGLSRAQPVQSKPQKASAPAADPPRYTFAPSVSLNKTARPFGAPPPADSAPQQNGQPLRPLV     71 - 140
PDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPW    141 - 210
PGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATPTPLQSRTSIVQAAAGGVPGGGSNNGKTP    211 - 280
VCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITG    281 - 350
EIMHALKMTWHVHCFTCAACKTPIRNRAFYMEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFS    351 - 420
WHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSHV                                     421 - 457
//

Text Mined References (51)

PMID Year Title