Property Summary

NCBI Gene PubMed Count 23
PubMed Score 261.22
PubTator Score 17.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Barrett's esophagus -1.100 3.6e-02
esophageal adenocarcinoma -2.200 1.8e-02
cystic fibrosis -1.018 3.4e-05
medulloblastoma, large-cell -2.000 1.4e-03
acute quadriplegic myopathy -1.119 6.8e-05
tuberculosis 2.000 7.4e-09
primary pancreatic ductal adenocarcinoma 1.016 8.7e-03
non-small cell lung cancer -1.822 1.1e-26
active Crohn's disease -1.344 6.6e-03
group 4 medulloblastoma -1.600 2.7e-03
pilocytic astrocytoma 1.200 4.4e-04
gastric carcinoma 1.700 6.7e-03
ulcerative colitis -1.500 1.8e-05
ovarian cancer 2.100 2.0e-07
pancreatic cancer 1.100 1.0e-02
head and neck cancer -1.100 2.4e-03

Gene RIF (12)

PMID Text
26499308 The suppression of PDLIM2 expression significantly reduced cell proliferation, cell growth and neoplasm invasiveness in prostate cancer cells.
25681443 epigenetic repression of PDLIM2 can be reversed by 5-aza-2-deoxycytidine and vitamin D to suppress KSHV-associated cancer cell growth
24863845 PDLIM2 expression is essential for feedback regulation of the beta1-integrin-RhoA signalling axis and integration of cellular microenvironment signals with gene expression to control the polarity of breast epithelial acini structures.
24196835 PDLIM2 integrates cytoskeleton signaling with gene expression in epithelial differentiation by controlling the stability of key transcription factors and COP9 signalosome activity.
23584482 PDLIM2 was a direct target gene of 1,25(OH)2D3
21814175 Pdlim2 is a novel actin-regulating protein of podocyte foot processes that may have a role in the pathogenesis of glomerular diseases.
20838382 PDLIM2 binds to Tax directly, which was mediated by a putative alpa-helix motif of PDLIM2 at amino acids 236-254.
20185823 PDLIM2, an essential terminator of NF-kappaB activation, is repressed in both estrogen receptor-positive and estrogen receptor-negative breast cancer cells, suggesting one important mechanism for the constitutive activation of NF-kappaB.
19794962 Data show that the PDLIM2 repression was independent of the viral regulatory protein Tax because neither short-term induction nor long-term stable expression of Tax could downregulate PDLIM2 expression.
19052146 Suppression of PDLIM2 expression resulted in decreased cell adhesion, increased NF-kappaB transcription reporter activity, and increased LPS-induced TNF-alpha production.
17468759 PDLIM2 deficiency resulted in larger amounts of nuclear p65, defective p65 ubiquitination and augmented production of proinflammatory cytokines in response to innate stimuli
15659642 Knockdown of Mystique 2 with small interfering RNA abrogated both adhesion and migration in MCF10A and MCF-7 cells

AA Sequence

MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKIR      1 - 70
QSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRSSYSSPTSLSPRAGSPFSPPP     71 - 140
SSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQAGLGRAGDSAVLVLPPSPGPRSSRPSMDSE    141 - 210
GGSLLLDEDSEVFKMLQENREGRAAPRQSSSFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATP    211 - 280
PKLHTCEKCSTSIANQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYSAPATLSS    281 - 350
RA                                                                        351 - 352
//

Text Mined References (26)

PMID Year Title
26499308 2016 PDLIM2 suppression efficiently reduces tumor growth and invasiveness of human castration-resistant prostate cancer-like cells.
25681443 2015 Oncovirus Kaposi sarcoma herpesvirus (KSHV) represses tumor suppressor PDLIM2 to persistently activate nuclear factor ?B (NF-?B) and STAT3 transcription factors for tumorigenesis and tumor maintenance.
24863845 2014 Essential function for PDLIM2 in cell polarization in three-dimensional cultures by feedback regulation of the ?1-integrin-RhoA signaling axis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24196835 2014 PDLIM2 regulates transcription factor activity in epithelial-to-mesenchymal transition via the COP9 signalosome.
23584482 2014 PDLIM2 expression is driven by vitamin D and is involved in the pro-adhesion, and anti-migration and -invasion activity of vitamin D.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21814175 2011 Pdlim2 is a novel actin-regulating protein of podocyte foot processes.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20838382 2010 Molecular determinants of PDLIM2 in suppressing HTLV-I Tax-mediated tumorigenesis.
20185823 2010 Epigenetic repression of PDZ-LIM domain-containing protein 2: implications for the biology and treatment of breast cancer.
19794962 2009 Human T-cell leukemia virus type I-mediated repression of PDZ-LIM domain-containing protein 2 involves DNA methylation but independent of the viral oncoprotein tax.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19052146 2009 Sequestration of PDLIM2 in the cytoplasm of monocytic/macrophage cells is associated with adhesion and increased nuclear activity of NF-kappaB.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17468759 2007 PDLIM2-mediated termination of transcription factor NF-kappaB activation by intranuclear sequestration and degradation of the p65 subunit.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15659642 2005 Mystique is a new insulin-like growth factor-I-regulated PDZ-LIM domain protein that promotes cell attachment and migration and suppresses Anchorage-independent growth.
15505042 2004 Pdlim2, a novel PDZ-LIM domain protein, interacts with alpha-actinins and filamin A.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12493773 2003 Global profiling of the cell surface proteome of cancer cells uncovers an abundance of proteins with chaperone function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214971 2000 Characterization of long cDNA clones from human adult spleen.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.