Property Summary

NCBI Gene PubMed Count 29
PubMed Score 248.65
PubTator Score 21.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.050 2.5e-02
glioblastoma 2.000 1.1e-05
ependymoma 1.600 7.4e-05
medulloblastoma, large-cell 3.200 1.4e-04
primitive neuroectodermal tumor 1.600 2.3e-02
chronic kidney disease 1.400 6.1e-03
lung cancer -3.700 1.1e-06
lung adenocarcinoma -1.500 1.3e-09
pediatric high grade glioma 1.600 1.4e-04
sonic hedgehog group medulloblastoma 1.100 6.0e-03
lung carcinoma -1.600 4.5e-22
spina bifida -1.550 4.9e-02
Breast cancer -1.500 1.3e-05
ovarian cancer 1.800 8.9e-04

Gene RIF (13)

PMID Text
26701804 downregulation of PDLIM1 in colorectal cancer samples correlated with reduced E-cadherin and membrane beta-catenin levels
26119933 PDLIM1 was shown to interact with p75(NTR) in highly invasive patient-derived glioma stem cells/tumor-initiating cells and shRNA knockdown of PDLIM1 in vitro and in vivo results in complete ablation of p75(NTR)-mediated invasion.
24662836 Our results identify CLP36 as an important regulator of breast cancer cell migration and metastasis, and shed light on how increased CLP36 expression contributes to the progression of breast cancer.
22922308 Femtomolar Zn2+ affinity of LIM domain of PDLIM1 protein uncovers crucial contribution of protein-protein interactions to protein stability.
22851037 Robust co-regulation of tyrosine phosphorylation sites has been revealed on novel protein interactions between EGFR and PDLIM1.
21680739 Alpha-actinin-4 and CLP36 protein deficiencies contribute to podocyte defects in multiple human glomerulopathies
21651830 PDLIM1 showed moderate parent-of origin effects for some single nucleotide polymorphisms in attention deficit disorder with hyperactivity.
17213842 Observational study of gene-disease association. (HuGE Navigator)
16609848 We present evidence for the exclusive protein expression of CLP36 in proliferative and early post-proliferative trophoblast cells.
16385451 Observational study of gene-disease association. (HuGE Navigator)
11973348 results establish the CLP-36 PDZ-LIM protein as an adapter, recruiting the Clik1 kinase to actin stress fibers in nonmuscle cells, and suggest that Clik1 represents a novel regulator of actin stress fibers
11110697 CLP-36 contains a PDZ- and LIM domain, is widely expressed, interacts with actinin-1, actinin-2 and actinin-4, and localizes to actin stress fibers. The gene (7 exons) is localised to contig NT_008878.2 on chromosome 10.
10861853 Enigma protein shown to interact with alpha actinin 2 by yeast two-hybrid screening and immunochemistry (co-localization at myocardial Z-disks).

AA Sequence

MTTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSNMTHLEAQNRI      1 - 70
KGCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAHNRSAMPFTASPASSTTARVI     71 - 140
TNQYNNPAGLYSSENISNFNNALESKTAASGVEANSRPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPP    141 - 210
KQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRH    211 - 280
PECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTVFPK                         281 - 329
//

Text Mined References (40)

PMID Year Title
26701804 2016 PDLIM1 Stabilizes the E-Cadherin/?-Catenin Complex to Prevent Epithelial-Mesenchymal Transition and Metastatic Potential of Colorectal Cancer Cells.
26119933 2016 Glioma invasion mediated by the p75 neurotrophin receptor (p75(NTR)/CD271) requires regulated interaction with PDLIM1.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24662836 2015 PDZ and LIM domain protein 1(PDLIM1)/CLP36 promotes breast cancer cell migration, invasion and metastasis through interaction with ?-actinin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22922308 2012 Femtomolar Zn2+ affinity of LIM domain of PDLIM1 protein uncovers crucial contribution of protein-protein interactions to protein stability.
22851037 2012 Robust co-regulation of tyrosine phosphorylation sites on proteins reveals novel protein interactions.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21680739 2011 Alpha-actinin-4 and CLP36 protein deficiencies contribute to podocyte defects in multiple human glomerulopathies.
21651830 2012 Parent-of-origin effects of FAS and PDLIM1 in attention-deficit/hyperactivity disorder.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21041247 2010 Genome-wide association study of suicide attempts in mood disorder patients.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17213842 2007 Refined genomic localization and ethnic differences observed for the IBD5 association with Crohn's disease.
16609848 2006 Expression of the actin stress fiber-associated protein CLP36 in the human placenta.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464179 2002 Identification of a Wnt/Dvl/beta-Catenin --> Pitx2 pathway mediating cell-type-specific proliferation during development.
11973348 2002 Clik1: a novel kinase targeted to actin stress fibers by the CLP-36 PDZ-LIM protein.
11882901 2002 Ubiquitination-dependent cofactor exchange on LIM homeodomain transcription factors.
11110697 2000 Human CLP36, a PDZ-domain and LIM-domain protein, binds to alpha-actinin-1 and associates with actin filaments and stress fibers in activated platelets and endothelial cells.
10861853 2000 Interaction of hCLIM1, an enigma family protein, with alpha-actinin 2.
10753915 2000 CLP-36 PDZ-LIM protein associates with nonmuscle alpha-actinin-1 and alpha-actinin-4.
10022510 1999 Characterization of the human 36-kDa carboxyl terminal LIM domain protein (hCLIM1).
8522188 1995 Cloning of a rat cDNA encoding a novel LIM domain protein with high homology to rat RIL.