Property Summary

NCBI Gene PubMed Count 24
PubMed Score 2.39
PubTator Score 20.38

Knowledge Summary

Patent (1,328)

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma 1.125 1.4e-03
colon cancer 2.400 3.7e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.9e-03
invasive ductal carcinoma 1.300 1.1e-02
lung cancer -2.300 2.6e-02
osteosarcoma 1.025 2.6e-02

Protein-protein Interaction (10)

Gene RIF (11)

AA Sequence

MRLFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDN      1 - 70
LLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVVPTMAQGVIEYKEKFGFD     71 - 140
PFISTNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQ    141 - 210
YYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKED    211 - 280
LSIKISDLGGGVPLRKIDRLFNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGV    281 - 350
GTDAVIYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQ                  351 - 406
//

Text Mined References (28)

PMID Year Title