Property Summary

NCBI Gene PubMed Count 22
PubMed Score 5.23
PubTator Score 20.38

Knowledge Summary

Patent (1,328)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.025 2.6e-02
adrenocortical carcinoma 1.125 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.9e-03
colon cancer 2.400 3.7e-02
lung cancer -2.300 2.6e-02
invasive ductal carcinoma 1.300 1.1e-02

Protein-protein Interaction (13)

Gene RIF (9)

PMID Text
24123565 Accordingly, elevated levels of PDK1, PDK3, and PKM2 and reduced PK activity could be observed in iPSCs and human embryonic stem cells in the undifferentiated state
23297365 Reduced pyruvate flux due to R158H mutant PDK3-mediated hyper-phosphorylation of the pyruvate dehydrogenase complex is the underlying pathogenic cause of peripheral neuropathy in X-linked dominant Charcot-Marie-Tooth disease.
22865452 Findings suggest the HIF-1/PDK3 bioenergetic pathway as a new target for therapeutic intervention in metastatic melanoma.
18718909 increased PDK3 expression due to elevated HIF-1alpha in cancer cells may play critical roles in metabolic switch during cancer progression and chemoresistance in cancer therapy
17683942 Distinct structural mechanisms for inhibition of PDK3 by AZD7545, dichloroacetate, and radicol.
17669420 PDK2, PDK3 and PDK4 are primary PPARbeta/delta target genes in humans underlining the importance of the receptor in the control of metabolism
17532006 crystal structure of the asymmetric PDHK3/lipoyl domain 2 complex; data suggest that the asymmetric complex represents a physiological state in which binding of a single L2-domain activates one of the PDHK protomers while inactivating another
16849321 analysis of residues in L2 and residues in the C-terminal region and the lipoyl-binding pocket of PDK3 which are critical determinants for the cross-talk between L2 and PDK3, which up-regulates PDK3 activity
14966024 mRNA levels not changed in skeletal muscle during fasting

AA Sequence

MRLFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDN      1 - 70
LLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVVPTMAQGVIEYKEKFGFD     71 - 140
PFISTNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQ    141 - 210
YYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKED    211 - 280
LSIKISDLGGGVPLRKIDRLFNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGV    281 - 350
GTDAVIYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQ                  351 - 406
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24123565 2014 HIF1? modulates cell fate reprogramming through early glycolytic shift and upregulation of PDK1-3 and PKM2.
23297365 2013 A new locus for X-linked dominant Charcot-Marie-Tooth disease (CMTX6) is caused by mutations in the pyruvate dehydrogenase kinase isoenzyme 3 (PDK3) gene.
22865452 2012 Inactivation of the HIF-1?/PDK3 signaling axis drives melanoma toward mitochondrial oxidative metabolism and potentiates the therapeutic activity of pro-oxidants.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20715114 2011 Butyrate elicits a metabolic switch in human colon cancer cells by targeting the pyruvate dehydrogenase complex.
18718909 2008 Induction of pyruvate dehydrogenase kinase-3 by hypoxia-inducible factor-1 promotes metabolic switch and drug resistance.
17683942 2007 Distinct structural mechanisms for inhibition of pyruvate dehydrogenase kinase isoforms by AZD7545, dichloroacetate, and radicicol.
17669420 2007 Three members of the human pyruvate dehydrogenase kinase gene family are direct targets of the peroxisome proliferator-activated receptor beta/delta.
17532006 2007 Crystal structure of an asymmetric complex of pyruvate dehydrogenase kinase 3 with lipoyl domain 2 and its biological implications.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16849321 2006 Structural determinants for cross-talk between pyruvate dehydrogenase kinase 3 and lipoyl domain 2 of the human pyruvate dehydrogenase complex.
16436377 2006 Characterization of testis-specific isoenzyme of human pyruvate dehydrogenase.
15861126 2005 Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15226823 2004 Genomic analysis of mouse retinal development.
14966024 2004 Pyruvate dehydrogenase activation and kinase expression in human skeletal muscle during fasting.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12676647 2003 Recent advances in mechanisms regulating glucose oxidation at the level of the pyruvate dehydrogenase complex by PDKs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12476789 2002 Therapeutic potential of the mammalian pyruvate dehydrogenase kinases in the prevention of hyperglycaemia.
11978179 2002 Interaction between the individual isoenzymes of pyruvate dehydrogenase kinase and the inner lipoyl-bearing domain of transacetylase component of pyruvate dehydrogenase complex.
11486000 2001 Site specificity of four pyruvate dehydrogenase kinase isoenzymes toward the three phosphorylation sites of human pyruvate dehydrogenase.
11485553 2001 Regulation of pyruvate dehydrogenase activity through phosphorylation at multiple sites.
10748134 2000 Marked differences between two isoforms of human pyruvate dehydrogenase kinase.
7499431 1995 Diversity of the pyruvate dehydrogenase kinase gene family in humans.