Property Summary

NCBI Gene PubMed Count 47
PubMed Score 45.12
PubTator Score 59.36

Knowledge Summary

Patent (5,561)

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease -1.353 3.1e-02
acute quadriplegic myopathy -1.198 5.9e-05
adult high grade glioma -1.100 8.6e-04
ductal carcinoma in situ -1.200 5.5e-04
glioblastoma -1.100 1.5e-06
inflammatory breast cancer -1.100 4.2e-02
juvenile dermatomyositis -1.048 2.2e-10
medulloblastoma, large-cell -1.100 4.4e-03
osteosarcoma 1.794 9.5e-05
sonic hedgehog group medulloblastoma -1.100 2.3e-04
subependymal giant cell astrocytoma -1.259 1.5e-02
ulcerative colitis -1.400 7.9e-10

 MGI Phenotype (1)

Gene RIF (27)

AA Sequence

MRWVWALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVRLANIMKEINL      1 - 70
LPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDT     71 - 140
YGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGSTNPAHPKHIGSIDPNCNVSEVVKDAYDMAKL    141 - 210
LCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVMVALG    211 - 280
EEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSME    281 - 350
GFGTDAVIYLKALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS                 351 - 407
//

Text Mined References (52)

PMID Year Title