Property Summary

NCBI Gene PubMed Count 27
PubMed Score 41.63
PubTator Score 30.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma multiforme 347 1.44617207689791E-24
non-small cell lung cancer 2798 2.53058344424059E-20
lung adenocarcinoma 2714 1.38954297412425E-10
posterior fossa group B ependymoma 1530 7.72120104398207E-10
atypical teratoid/rhabdoid tumor 1095 5.27956318028428E-7
pituitary cancer 1972 8.70769587304435E-7
lung cancer 4473 2.83334126408486E-6
ulcerative colitis 2087 4.80563017372323E-6
psoriasis 6685 5.42175631355982E-6
osteosarcoma 7933 9.81534800716457E-6
pediatric high grade glioma 2712 1.37197781466034E-5
ovarian cancer 8492 2.51573035218671E-5
pilocytic astrocytoma 3086 3.02474454294112E-4
ductal carcinoma in situ 1745 6.92146938012441E-4
invasive ductal carcinoma 2950 0.00133439298822522
group 3 medulloblastoma 2254 0.00178739286382753
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00359985860665789
primitive neuroectodermal tumor 3031 0.00388774764778225
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00470417907614724
active Crohn's disease 918 0.0051280157316474
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00614631126779561
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0071846864313065
astrocytoma 1493 0.00862163010488107
subependymal giant cell astrocytoma 2287 0.00979021757668597
esophageal adenocarcinoma 737 0.0179350527878244
cutaneous lupus erythematosus 1056 0.0190322528105549
Breast cancer 3099 0.0248500771095734
non primary Sjogren syndrome sicca 840 0.0268040483676636
pancreatic cancer 2300 0.0309378669572974
pancreatic carcinoma 567 0.0309378669572975
diabetes mellitus 1663 0.0472655684318708
Disease Target Count Z-score Confidence
Multiple epiphyseal dysplasia 12 3.436 1.7

Expression

Synonym

Accession P13667 A8K4K6 Q549T6
Symbols ERP70
ERP72
ERp-72

Gene

PDB

3IDV  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (14)

PMID Text
24599957 the faster migrating Tg adduct C primarily engages the CaBP1/P5 oxidoreductase, whereas the slower migrating Tg adduct A primarily engages ERp72.
24464223 CDDP-resistant non-small lung cancer cells undergo profound remodeling of their endoplasmic reticulum (ER) proteome (>80 proteins identified by proteomics) and exhibit a dramatic overexpression of two protein disulfide isomerases, PDIA4 and PDIA6.
23206338 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
22230366 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
22190034 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
21743296 novel esophageal squamous cell carcinoma marker PDIA4 was identified by mass spectrometry and immunohistochemical analysis
20458450 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
19834535 Observational study of gene-disease association. (HuGE Navigator)
18620548 Nox1 associates with ERp72, which involves its N-terminus encompassing a Ca(2+)-binding site and the first TRX-like motif.
17301129 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
More...

AA Sequence

MRPRKAFLLLLLLGLVQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDA      1 - 70
NFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTI     71 - 140
KILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCK    141 - 210
KLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMI    211 - 280
EQSGPPSKEILTLKQVQEFLKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKV    281 - 350
SQGQLVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYS    351 - 420
VDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEP    421 - 490
EEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQ    491 - 560
LEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGGDRDLEHLSKF    561 - 630
IEEHATKLSRTKEEL                                                           631 - 645
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24599957 2014 Transient covalent interactions of newly synthesized thyroglobulin with oxidoreductases of the endoplasmic reticulum.
24464223 2014 The protein disulfide isomerases PDIA4 and PDIA6 mediate resistance to cisplatin-induced cell death in lung adenocarcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22665516 2012 An interaction map of endoplasmic reticulum chaperones and foldases.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22190034 2011 Global landscape of HIV-human protein complexes.
21743296 2011 Quantitative tissue proteomics of esophageal squamous cell carcinoma for novel biomarker discovery.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
More...