1. Home
  2. Targets
  3. Protein disulfide-isomerase A4

Tbio Protein disulfide-isomerase A4


 Comments

Property Summary

NCBI Gene PubMed Count 27
PubMed Score 41.63
PubTator Score 30.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Multiple epiphyseal dysplasia 12 3.436 1.7

Expression

  Differential Expression (31)

Disease log2 FC p
pancreatic cancer 1.100 3.1e-02
esophageal adenocarcinoma 1.400 1.8e-02
cutaneous lupus erythematosus 1.400 1.9e-02
psoriasis -3.500 5.4e-06
glioblastoma multiforme 1.700 1.4e-24
osteosarcoma 2.747 9.8e-06
posterior fossa group B ependymoma 2.000 7.7e-10
group 3 medulloblastoma 1.600 1.8e-03
astrocytoma 1.300 8.6e-03
atypical teratoid/rhabdoid tumor 1.500 5.3e-07
primitive neuroectodermal tumor 1.100 3.9e-03
pancreatic ductal adenocarcinoma liver m... -2.148 6.1e-03
non-small cell lung cancer 1.519 2.5e-20
intraductal papillary-mucinous adenoma (... 1.100 7.2e-03
intraductal papillary-mucinous carcinoma... 1.700 4.7e-03
intraductal papillary-mucinous neoplasm ... 1.600 3.6e-03
lung cancer 2.500 2.8e-06
active Crohn's disease 1.194 5.1e-03
diabetes mellitus -1.400 4.7e-02
Breast cancer 3.300 2.5e-02
pediatric high grade glioma 1.600 1.4e-05
pilocytic astrocytoma 1.100 3.0e-04
non primary Sjogren syndrome sicca 1.100 2.7e-02
pancreatic carcinoma 1.100 3.1e-02
subependymal giant cell astrocytoma 1.263 9.8e-03
lung adenocarcinoma 2.002 1.4e-10
ductal carcinoma in situ 1.200 6.9e-04
invasive ductal carcinoma 1.300 1.3e-03
ulcerative colitis 1.200 4.8e-06
ovarian cancer 2.400 2.5e-05
pituitary cancer -1.400 8.7e-07

Synonym

Accession P13667 A8K4K6 Q549T6
Symbols ERP70
ERP72
ERp-72

Gene

PDIA4

PDB

3IDV  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (12)

See all...

 GO Function (2)

 GO Component (3)

 GO Process (5)

 Compartment GO Term (29)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (17)

See all...

Protein-protein Interaction (1)

EMC7  

Gene RIF (14)

PMID Text
24599957 the faster migrating Tg adduct C primarily engages the CaBP1/P5 oxidoreductase, whereas the slower migrating Tg adduct A primarily engages ERp72.
24464223 CDDP-resistant non-small lung cancer cells undergo profound remodeling of their endoplasmic reticulum (ER) proteome (>80 proteins identified by proteomics) and exhibit a dramatic overexpression of two protein disulfide isomerases, PDIA4 and PDIA6.
23206338 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
22230366 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
22190034 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
21743296 novel esophageal squamous cell carcinoma marker PDIA4 was identified by mass spectrometry and immunohistochemical analysis
20458450 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
19834535 Observational study of gene-disease association. (HuGE Navigator)
18620548 Nox1 associates with ERp72, which involves its N-terminus encompassing a Ca(2+)-binding site and the first TRX-like motif.
17301129 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
16182193 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
15644496 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
12218052 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
12218051 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells

AA Sequence 

MRPRKAFLLLLLLGLVQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDA      1 - 70
NFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTI     71 - 140
KILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCK    141 - 210
KLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMI    211 - 280
EQSGPPSKEILTLKQVQEFLKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKV    281 - 350
SQGQLVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYS    351 - 420
VDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEP    421 - 490
EEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQ    491 - 560
LEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGGDRDLEHLSKF    561 - 630
IEEHATKLSRTKEEL                                                           631 - 645
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24599957 2014 Transient covalent interactions of newly synthesized thyroglobulin with oxidoreductases of the endoplasmic reticulum.
24464223 2014 The protein disulfide isomerases PDIA4 and PDIA6 mediate resistance to cisplatin-induced cell death in lung adenocarcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22665516 2012 An interaction map of endoplasmic reticulum chaperones and foldases.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22190034 2011 Global landscape of HIV-human protein complexes.
21743296 2011 Quantitative tissue proteomics of esophageal squamous cell carcinoma for novel biomarker discovery.
21269460 2011 Initial characterization of the human central proteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
19995400 2010 Platelets release novel thiol isomerase enzymes which are recruited to the cell surface following activation.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18620548 2008 A possible biochemical link between NADPH oxidase (Nox) 1 redox-signalling and ERp72.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12643545 Proteomic analysis of early melanosomes: identification of novel melanosomal proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475965 2002 A subset of chaperones and folding enzymes form multiprotein complexes in endoplasmic reticulum to bind nascent proteins.
12397072 2003 Nascent lipidated apolipoprotein B is transported to the Golgi as an incompletely folded intermediate as probed by its association with network of endoplasmic reticulum molecular chaperones, GRP94, ERp72, BiP, calreticulin, and cyclophilin B.
9847074 1998 Toward a complete human genome sequence.
9694898 1998 Multiple molecular chaperones interact with apolipoprotein B during its maturation. The network of endoplasmic reticulum-resident chaperones (ERp72, GRP94, calreticulin, and BiP) interacts with apolipoprotein b regardless of its lipidation state.
9006956 1997 Multiple molecular chaperones complex with misfolded large oligomeric glycoproteins in the endoplasmic reticulum.
2549034 1989 Human deoxycytidine kinase. Sequence of cDNA clones and analysis of expression in cell lines with and without enzyme activity.
2295602 1990 ERp72, an abundant luminal endoplasmic reticulum protein, contains three copies of the active site sequences of protein disulfide isomerase.
2002068 1991 Human deoxycytidine kinase. Sequence of cDNA clones and analysis of expression in cell lines with and without enzyme activity.
1512535 1992 HLA-DR associates with specific stress proteins and is retained in the endoplasmic reticulum in invariant chain negative cells.
1318337 1992 An antibody that binds a neutrophil membrane protein, ERp72, primes human neutrophils for enhanced oxidative metabolism in response to formyl-methionyl-leucyl-phenylalanine. Implications for ERp72 in the signal transduction pathway for neutrophil priming.