Property Summary

NCBI Gene PubMed Count 136
PubMed Score 296.85
PubTator Score 212.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.233 1.8e-02
astrocytoma 1.500 1.2e-02
osteosarcoma -1.128 1.9e-03
ependymoma 1.400 9.5e-13
glioblastoma 1.500 7.5e-03
Duchenne muscular dystrophy 1.087 4.2e-08
juvenile dermatomyositis 1.633 1.5e-13
acute quadriplegic myopathy 1.365 2.5e-06
pancreatic ductal adenocarcinoma liver m... -2.381 9.0e-03
intraductal papillary-mucinous adenoma (... 1.200 8.3e-04
intraductal papillary-mucinous carcinoma... 1.600 7.4e-04
active Crohn's disease 1.132 1.0e-02
lung adenocarcinoma 2.001 2.7e-10
ovarian cancer 3.200 2.1e-05

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652266 other 0 / 0 / 12 Selectivity Screen to determine compound activity against other thiol isomerases: ERp57 Measured in Biochemical System Using Plate Reader - 2137-09_Inhibitor_Dose_DryPowder_Activity

Gene RIF (101)

PMID Text
26869642 Amyotrophic lateral sclerosis-linked PDIA3 mutations disrupt motor neuron connectivity.
26772958 These data indicate that the presence of autoantibodies to PDIA3 favors the development of an efficient and specific T-cell response against PDIA3 in colorectal cancer patients.
26771192 LEDGF/p75 Overexpression Attenuates Oxidative Stress-Induced Necrosis and Upregulates the Oxidoreductase ERP57/PDIA3/GRP58 in Prostate Cancer
26724776 it is possible that the vimentin and PDIA3 could be the candidate biomarkers specific to Achyranthes saponin therapy for rheumatoid arthritis in synovial membrane.
26435004 ERp57 levels are increased in the airway epithelium of asthmatic patients and in mice with allergic airways disease.
26402295 Data suggest that regulation of PDIA3 (protein disulfide isomerase associated 3 protein) expression by microRNA-330-5p is important in maintaining hair cycle through regulation of proliferation and migration capability of keratinocytes.
26361352 ERp57 specifically contributes to peripheral nerve regeneration, whereas its activity is dispensable for the survival of a specific neuronal population of the central nervous system.
26214517 results suggested that ER chaperone PDIA3 plays a pivotal role in FFA-induced hepatocyte steatosis and apoptosis.
26170458 study identifies ERp57 as a new modulator of PrP levels and may help with understanding the consequences of ERp57 up-regulation observed in human disease
26125904 PDIA3 and PDIA6 gene expression is a neoplasm aggressiveness marker in primary ductal breast cancer.
26004124 miR148a inhibits the proliferation and promotes paclitaxelinduced apoptosis of ovarian cancer cells, and this may be partly attributed to direct targeting of PDIA3.
25837926 Its cross-reaction to GFAP antibodies seems to lead to a changed signaling in the cells triggering the protective effects.
25763817 The sPLA2-hPDI model constitutes a valuable tool to facilitate further insights into this process and into the (patho)physiology of sPLA2s in relation to their action intracellularly.
25605256 Suggest that ERp57-STAT3 regulation functions in radioresistance of laryngeal cancer.
25221425 Reported increased expression of ALDH3A1, PDIA3, and PRDX2 in pterygia using a proteomic approach. These proteins are presumed to have a protective role against oxidative stress-induced apoptosis.
25081282 Results demonstrated that Grp58 appears to regulate WNT signaling by targeting beta-catenin to augment cancer invasion.
24825317 HIV-1 gp120/MBL complex co-localizes with the ER marker ERp57 and the Golgi marker p230 at subcellular perinuclear compartments in neuronal cells
24815697 ERp57 can regulate the expression of the mitochondrial calcium uniporter (MCU) and modulate mitochondrial calcium uptake
24599957 Tg "adduct B" was identified as primarily engaging the endoplasmic reticulum oxidoreductases ERp57 and protein disulfide isomerase
24490732 Increased expression of the AGR2 and ERp57 is associated with cancer. [review]
24188822 ERp57 positively regulates H(+),K(+)-ATPase activity apart from its chaperoning function.
24040290 Stepwise assembly of fibrinogen is assisted by the endoplasmic reticulum ERp57 lectin-chaperone system in a human hepatocyte cell line.
24030382 Platelets lacking ERp57 have defective activation of the alphaIIbbeta3 integrin and platelet aggregation. The defect in aggregation was corrected by the addition of exogenous ERp57, implicating surface ERp57 in platelet aggregation.
23957851 Low ERp57 expression independently predicts a poor outcome for patients with cervical cancer.
23874603 HIV-1 gp120/MBL complex co-localizes with the ER marker ERp57 and the Golgi marker p230 at subcellular perinuclear compartments in neuronal cells
23827315 We postulate that apoB cleavage by ER-60 within the ER lumen could facilitate proteasomal degradation of the C-terminus of translocationally-arrested apoB.
23782473 Increased expression of PDIA3 is associated with tumor progression and the clinical behavior of gallbladder carcinoma.
23781031 ERP57 was excreted in the early stages of chronic kidney disease, and its level in urine correlated with the degree of renal fibrosis, suggesting that the secretion of ERP57 represents one of the first signs of renal fibrosis onset and progression.
23625662 ERp57 appears as a multifunctional chaperone that can regulate diverse biological processes to maintain the homeostasis of breast cancer cells and promote the development of bone metastasis.
23587917 Nuclear ERp57 interacts in vivo with DNA fragments in melanoma cells and is potentially involved in the transcriptional regulation of its target genes.
23255428 Low PDIA3 expression is associated with chemoresistant colon tumors.
23226417 ERp57 regulates RalA signalling by acting as a redox-sensitive guanine-nucleotide dissociation inhibitor.
23206338 HIV-1 gp120/MBL complex co-localizes with the ER marker ERp57 and the Golgi marker p230 at subcellular perinuclear compartments in neuronal cells
22944692 HIV-1 gp120/MBL complex co-localizes with the ER marker ERp57 and the Golgi marker p230 at subcellular perinuclear compartments in neuronal cells
22923333 Data indicate that the peptide-loading complex (PLC) consists maximally of 2x tapasin-ERp57/MHC I per TAP complex, but one tapasin-ERp57/MHC I in the PLC is essential and sufficient for antigen processing.
22503978 PDIA3 may play in the progression of heart failure.
22322599 the vitamin D receptor (VDR) and ERp57 are critical components for actions of 1,25 dihydroxy vitamin D 3 against DNA damage, but the VDR does not require normal DNA binding or classical ligand binding to mediate photoprotection.
22266712 Downregulation of ER60 protease is associated with inhibition of cell proliferation in breast cancer cells in vitro.
22230366 HIV-1 gp120/MBL complex co-localizes with the ER marker ERp57 and the Golgi marker p230 at subcellular perinuclear compartments in neuronal cells
22207023 These results suggest that increased level of hnRNP-H and PDIA3 expression in Dengue virus infected THP1 cells assist in the viral replication by suppressing the TNF-alpha production.
22190034 HIV-1 gp120/MBL complex co-localizes with the ER marker ERp57 and the Golgi marker p230 at subcellular perinuclear compartments in neuronal cells
22168334 ERp57 has roles in multiple components of platelet function and arterial thrombus formation.
21996511 kinetic, extent and stability of the ERp57-CRT complex, using the surface plasmon resonance spectroscopy
21917082 Grp58 is highly expressed in patients with serious cervical stromal penetration, and further supports the theory that Grp58 is critical for cervical AD progression.
21840908 PDIA3 and GRP78 are IL11 targets in invasive trophoblasts
21837552 ERp57 participates in signal transduction from the cell surface, in regulatory processes taking place in the nucleus, and in multimeric protein complexes involved in DNA repair. (Review)
21598303 Immunostaining for both ERp57-GFP and p65 after TNF-alpha treatment indicated that nuclear translocation of these two proteins occurs independently
21362330 HLA-I, TAP1, CNX, LMP7, Erp57, Tapasin and ERAP1 were down-regulated in 68%, 44%, 48%, 40%, 52%, 32% and 20% of esophageal squamous cell carcinoma lesions then, respectively.
21321085 results suggest that GRp58/ERp57 is involved in the assembly of mTORC1 and positively regulates mTORC1 signaling at the cytosol and the cytosolic side of the endoplasmic reticulum
20596672 The involvement of the nuclear ERp57 complex in mechanisms associated with chromosome segregation in which specific conformational states of actin play a role in the pathway involved in paclitaxel resistance.
20596667 ER-60 (PDIA3) is overexpressed in a serous ovarian cancer cell line and should be investigated further as a potential biomarker of ovarian cancer.
20506389 Data suggest that further investigations are warranted to verify the involvement of ERp57 in NAFLD development.
20458450 HIV-1 gp120/MBL complex co-localizes with the ER marker ERp57 and the Golgi marker p230 at subcellular perinuclear compartments in neuronal cells
20064506 findings suggests a role for 1,25D(3)-MARRS (PDIA3)in the nucleus as a regulator of gene expression; here it may also regulate the activity of NFkappaB and other factors with which it may be interacting
20035634 genes MAP3K5 and PDIA3 are associated with malignant stages of prostate cancer and therefore provide novel potential biomarkers
20029959 t\The over expression of protein disulfide isomerase family A led to an gonadotropin releasing hormone receptor retention in plasma membrane.
19995546 ERp57 is a necessary cofactor for the regulation of at least a subset of STAT3-dependent genes.
19714814 ERp57 plays an important role in chemoresistance mechanisms in ovarian cancer by modulating the attachment of microtubules to chromosomes following paclitaxel treatment through its interaction with TUBB3.
19701894 tapasin conjugation with ERp57 is as critical as its integration into the membrane for efficient MHC class I assembly, surface expression, and Ag presentation to CD8+ T cells.
19411306 Knockdown of ERp57 confers cellular protection against hyperoxia- or tunicamycin-induced apoptosis by inhibition of caspase-3 activation and stimulation of BiP/GRP78 induction.
19119025 the 2.6 A resolution structure of the tapasin-ERp57 core of the peptide-loading complex
19064571 Observational study of gene-disease association. (HuGE Navigator)
19054761 ERp57 must be physically associated with the calnexin cycle to catalyze isomerization reactions with most of its substrates
18976975 Knockdown of protein disulfide isomerase family A, member 3 (PDIA3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18650385 the function of ERp57 in peptide loading is likely caused by other ERp57 functional domains or a combinatorial feature of the tapasin-ERp57 conjugate
18039656 A ternary complex between heavy chain, ERp57, and tapasin was observed and shown to be stabilized by a disulfide between both tapasinheavy chain and tapasin-ERp57.
17964282 Valsartan, a selective Ang II type 1 (AT1) receptor blocker, and N-acetylcysteine, an antioxidant, inhibited both of these modifications, indicating the contribution of AT1 receptor and reactive oxygen species to oxidation of Prx2.
17848102 Cell stress induced by the parkinsonian mimetic, oxidopamine, is concurrent with oxidation of the chaperone, ERp57, and aggresome formation.
17822402 the presence of ERp57 is important for the stability of core loading complexes, and in its absence, the core loading complexes may form stable aggregates within the ER
17728248 Endoplasmic reticulum chaperones stabilize nicotinic receptor subunits and regulate receptor assembly.
17704119 Results show that ERp57 is a component of human sperm acrosome proteins, which play a critical role in gamete fusion. ERp57 could be a novel phenotype marker for male infertility and has the potential to be used to assess sperm selection for IVF.
17456022 ERp57 is involved in differentiation of certain cancer cells and in muscle function.
17301129 HIV-1 gp120/MBL complex co-localizes with the ER marker ERp57 and the Golgi marker p230 at subcellular perinuclear compartments in neuronal cells
17188166 loss of ERp57 expression correlated with more aggressive disease and could provide useful prognostic information for gastric cancer patients
17170699 ERp57 has a role in the isomerisation of non-native disulphide bonds in specific glycoprotein substrates
17150345 Recruitment of major histocompatibility complex class I molecules into the peptide-loading complex in the endoplasmic reticulum is a structural role for ERp57.
17061245 We would suggest that at least part of the mechanism of action of ERp57/GRP58 takes place through the regulation of still- unidentified stress-response genes.
16962936 ERp57 appears to cooperate with Ref-1 in the regulation of gene expression mediated by redox-sensitive transcription factors and in the adaptive response of the cell to oxidative insult.
16940051 ERp27 is bound by ERp57 both in vitro and in vivo by a similar mechanism by which ERp57 binds calreticulin
16428306 analyzed the cooperation of ER-60 and BiP in the oxidative refolding of denatured proteins
16368681 analysis of the role of PDI in native disulfide bond formation
16193070 Tapasin association specifically inhibits the escape pathway required for disulfide-bond isomerization within conventional protein substrates, suggesting a specific structural role for ERp57 within the MHC class I peptide-loading complex.
16182193 HIV-1 gp120/MBL complex co-localizes with the ER marker ERp57 and the Golgi marker p230 at subcellular perinuclear compartments in neuronal cells
16002696 ERp57 is detected in neonatal Fc receptor (FcRn)-calnexin complexes, suggesting its role in disulfide bond formation of FcRn heavy chain.
15896298 Based on immunoblotting studies of cerebrospinal fluid (CSF) from normals, we find that the bulk of the abetas are bound to the ER chaperones, ERp57 and calreticulin.
15862831 1,25D3-MARRS protein and vitamin D receptor work together to fine tune intestinal Ca2+ absorption
15644496 HIV-1 gp120/MBL complex co-localizes with the ER marker ERp57 and the Golgi marker p230 at subcellular perinuclear compartments in neuronal cells
15451439 Considering the functional association of the two proteins, the overexpression of ERp57 observed in a variety of transformed cells might be relevant to the oncogenic properties of STAT3.
15328618 ERp57 shares functional properties with protein disulfide isomerase and that both are clearly different from other oxidoreductases
15236594 identification of the site of interaction with calnexin and calreticulin; the contribution of both the b and b' domains to the binding with CNX and CRT was revealed
14871899 propose a model where the region of ERp57 equivalent to the primary substrate binding site of archetypal PDI is occupied by calreticulin and suggest that the ER lectins act as adaptor molecules that define the substrate specificity of ERp57
14871896 characterized several fundamental structural and functional properties of ERp57, such as domain organization, shape, redox potential, and the ability to catalyze disulfide reduction, disulfide isomerization, and dithiol oxidation in substrate proteins
14732712 multiple domains are involved in this protein-protein interaction and that the b' domain of ERp57 cannot be replaced by that of protein disulfide isomerase
12239218 Data show that CD1d associates in the ER with both calnexin and calreticulin and with the thiol oxidoreductase ERp57 in a manner dependent on glucose trimming of its N-linked glycans.
12235131 role in class I loading process
12218052 HIV-1 gp120/MBL complex co-localizes with the ER marker ERp57 and the Golgi marker p230 at subcellular perinuclear compartments in neuronal cells
12218051 HIV-1 gp120/MBL complex co-localizes with the ER marker ERp57 and the Golgi marker p230 at subcellular perinuclear compartments in neuronal cells
12162574 Transglutaminase activity of human ER-60
12060494 Stat3 and GRP58 were observed to be coassociated with cytoplasmic membranes
12032078 The oxidoreductase ERp57 efficiently reduces partially folded in preference to fully folded MHC class I molecules.
11842220 We found that ERp57 binds to the P-domain of calreticulin, an independently folding domain comprising residues 189-288.

AA Sequence

MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAA      1 - 70
ATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLR     71 - 140
TEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSH    141 - 210
LTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWR    211 - 280
NRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALE    281 - 350
RFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG    351 - 420
EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVI    421 - 490
QEEKPKKKKKAQEDL                                                           491 - 505
//

Text Mined References (146)

PMID Year Title
26869642 2016 ALS-linked protein disulfide isomerase variants cause motor dysfunction.
26772958 2016 Protein disulfide isomerase A3-specific Th1 effector cells infiltrate colon cancer tissue of patients with circulating anti-protein disulfide isomerase A3 autoantibodies.
26771192 2016 LEDGF/p75 Overexpression Attenuates Oxidative Stress-Induced Necrosis and Upregulates the Oxidoreductase ERP57/PDIA3/GRP58 in Prostate Cancer.
26724776 2016 Identification of candidate synovial membrane biomarkers after Achyranthes aspera treatment for rheumatoid arthritis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26435004 2016 Protein disulfide isomerase-endoplasmic reticulum resident protein 57 regulates allergen-induced airways inflammation, fibrosis, and hyperresponsiveness.
26402295 2015 miR-330-5p inhibits proliferation and migration of keratinocytes by targeting Pdia3 expression.
26361352 2015 Functional Role of the Disulfide Isomerase ERp57 in Axonal Regeneration.
26214517 2015 PDIA3 Knockdown Exacerbates Free Fatty Acid-Induced Hepatocyte Steatosis and Apoptosis.
26170458 2015 The Protein-disulfide Isomerase ERp57 Regulates the Steady-state Levels of the Prion Protein.
26125904 2015 PDIA3 and PDIA6 gene expression as an aggressiveness marker in primary ductal breast cancer.
26004124 2015 MicroRNA-148a inhibits the proliferation and promotes the paclitaxel-induced apoptosis of ovarian cancer cells by targeting PDIA3.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25837926 2015 GFAP antibodies show protective effect on oxidatively stressed neuroretinal cells via interaction with ERP57.
25763817 2015 On the role of protein disulfide isomerase in the retrograde cell transport of secreted phospholipases A2.
25605256 2015 ERp57 modulates STAT3 activity in radioresistant laryngeal cancer cells and serves as a prognostic marker for laryngeal cancer.
25221425 2014 Proteomic analysis in pterygium; upregulated protein expression of ALDH3A1, PDIA3, and PRDX2.
25081282 2014 Glucose-regulated protein 58 modulates ?-catenin protein stability in a cervical adenocarcinoma cell line.
24815697 2014 ERp57 modulates mitochondrial calcium uptake through the MCU.
24599957 2014 Transient covalent interactions of newly synthesized thyroglobulin with oxidoreductases of the endoplasmic reticulum.
24490732 2013 AGR2, ERp57/GRP58, and some other human protein disulfide isomerases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24188822 2013 Modulation of H(+),K(+)-ATPase activity by the molecular chaperone ERp57 highly expressed in gastric parietal cells.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24040290 2013 Stepwise assembly of fibrinogen is assisted by the endoplasmic reticulum lectin-chaperone system in HepG2 cells.
24030382 2013 Platelet-derived ERp57 mediates platelet incorporation into a growing thrombus by regulation of the ?IIb?3 integrin.
23957851 2013 Downregulation of ERp57 expression is associated with poor prognosis in early-stage cervical cancer.
23827315 2013 Role of cysteine-protease CGHC motifs of ER-60, a protein disulfide isomerase, in hepatic apolipoprotein B100 degradation.
23826168 2013 SERPINA2 is a novel gene with a divergent function from SERPINA1.
23782473 2013 Clinicopathological features and CCT2 and PDIA2 expression in gallbladder squamous/adenosquamous carcinoma and gallbladder adenocarcinoma.
23781031 2013 Secretion of ERP57 is important for extracellular matrix accumulation and progression of renal fibrosis, and is an early sign of disease onset.
23625662 2013 A transcriptome-proteome integrated network identifies endoplasmic reticulum thiol oxidoreductase (ERp57) as a hub that mediates bone metastasis.
23587917 2013 ERp57/PDIA3 binds specific DNA fragments in a melanoma cell line.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23255428 2014 Differential proteomics identifies PDIA3 as a novel chemoprevention target in human colon cancer cells.
23226417 2012 Identification and characterisation of the RalA-ERp57 interaction: evidence for GDI activity of ERp57.
22923333 2012 Molecular architecture of the MHC I peptide-loading complex: one tapasin molecule is essential and sufficient for antigen processing.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22665516 2012 An interaction map of endoplasmic reticulum chaperones and foldases.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22503978 2012 Serendipitous discovery of a novel protein signaling mechanism in heart failure.
22322599 2012 The role of the vitamin D receptor and ERp57 in photoprotection by 1?,25-dihydroxyvitamin D3.
22266712 2012 Downregulation of ER60 protease inhibits cellular proliferation by inducing G1/S arrest in breast cancer cells in vitro.
22207023 2012 Dengue virus infection induces upregulation of hn RNP-H and PDIA3 for its multiplication in the host cell.
22168334 2012 The platelet-surface thiol isomerase enzyme ERp57 modulates platelet function.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
21996511 2012 Interaction of ERp57 with calreticulin: Analysis of complex formation and effects of vancomycin.
21941299 2011 Modulation of STIM1 and capacitative Ca2+ entry by the endoplasmic reticulum luminal oxidoreductase ERp57.
21917082 2011 Glucose-regulated protein 58 modulates cell invasiveness and serves as a prognostic marker for cervical cancer.
21840908 2011 Interleukin (IL)11 mediates protein secretion and modification in human extravillous trophoblasts.
21837552 2011 ERp57/GRP58: a protein with multiple functions.
21670307 2011 Galectin-9 binding to cell surface protein disulfide isomerase regulates the redox environment to enhance T-cell migration and HIV entry.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21598303 2011 Tumor necrosis factor-? treatment of HepG2 cells mobilizes a cytoplasmic pool of ERp57/1,25D?-MARRS to the nucleus.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21362330 2011 Association of defective HLA-I expression with antigen processing machinery and their association with clinicopathological characteristics in Kazak patients with esophageal cancer.
21321085 2011 Regulation of mTORC1 complex assembly and signaling by GRp58/ERp57.
21269460 2011 Initial characterization of the human central proteome.
21057456 2010 Recycling of peroxiredoxin IV provides a novel pathway for disulphide formation in the endoplasmic reticulum.
20802462 2010 Disulphide production by Ero1?-PDI relay is rapid and effectively regulated.
20596672 2010 Characterisation of a multimeric protein complex associated with ERp57 within the nucleus in paclitaxel-sensitive and -resistant epithelial ovarian cancer cells: the involvement of specific conformational states of beta-actin.
20596667 2010 ER-60 (PDIA3) is highly expressed in a newly established serous ovarian cancer cell line, YDOV-139.
20506389 2010 ERp57 is up-regulated in free fatty acids-induced steatotic L-02 cells and human nonalcoholic fatty livers.
20400973 2010 Glucose-regulated protein precursor (GRP78) and tumor rejection antigen (GP96) are unique to hamster caput epididymal spermatozoa.
20064506 2010 Nuclear translocation of the 1,25D3-MARRS (membrane associated rapid response to steroids) receptor protein and NFkappaB in differentiating NB4 leukemia cells.
20035634 2009 Differential expression of apoptotic genes PDIA3 and MAP3K5 distinguishes between low- and high-risk prostate cancer.
20029959 2010 Protein disulfide isomerase chaperone ERP-57 decreases plasma membrane expression of the human GnRH receptor.
19995546 2010 Role of ERp57 in the signaling and transcriptional activity of STAT3 in a melanoma cell line.
19995400 2010 Platelets release novel thiol isomerase enzymes which are recruited to the cell surface following activation.
19714814 2009 Comparative proteomic analysis of paclitaxel sensitive A2780 epithelial ovarian cancer cell line and its resistant counterpart A2780TC1 by 2D-DIGE: the role of ERp57.
19701894 2009 Functional significance of tapasin membrane association and disulfide linkage to ERp57 in MHC class I presentation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19411306 2009 Knockdown of ERp57 increases BiP/GRP78 induction and protects against hyperoxia and tunicamycin-induced apoptosis.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19119025 2009 Insights into MHC class I peptide loading from the structure of the tapasin-ERp57 thiol oxidoreductase heterodimer.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
19054761 2009 Substrate specificity of the oxidoreductase ERp57 is determined primarily by its interaction with calnexin and calreticulin.
18650385 2008 The redox activity of ERp57 is not essential for its functions in MHC class I peptide loading.
18303019 2008 Getting in and out from calnexin/calreticulin cycles.
18039656 2008 Formation of a major histocompatibility complex class I tapasin disulfide indicates a change in spatial organization of the peptide-loading complex during assembly.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17964282 2007 Oxidation of Prx2 and phosphorylation of GRP58 by angiotensin II in human coronary smooth muscle cells identified by 2D-DIGE analysis.
17848102 2007 Cell stress induced by the parkinsonian mimetic, 6-hydroxydopamine, is concurrent with oxidation of the chaperone, ERp57, and aggresome formation.
17822402 2007 Aggregate formation by ERp57-deficient MHC class I peptide-loading complexes.
17728248 2007 Endoplasmic reticulum chaperones stabilize nicotinic receptor subunits and regulate receptor assembly.
17704119 2007 ERp57 is a potential biomarker for human fertilization capability.
17456022 2007 The ERp57/GRp58/1,25D3-MARRS receptor: multiple functional roles in diverse cell systems.
17188166 2007 Expression and prognostic significance of prothymosin-alpha and ERp57 in human gastric cancer.
17170699 2007 ERp57 is essential for efficient folding of glycoproteins sharing common structural domains.
17150345 2007 Interaction of ERp57 and tapasin in the generation of MHC class I-peptide complexes.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
17061245 2007 The stress protein ERp57/GRP58 binds specific DNA sequences in HeLa cells.
17055437 2006 Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing.
16962936 2006 Cooperative activity of Ref-1/APE and ERp57 in reductive activation of transcription factors.
16940051 2006 ERp27, a new non-catalytic endoplasmic reticulum-located human protein disulfide isomerase family member, interacts with ERp57.
16905107 2006 Crystal structure of the bb' domains of the protein disulfide isomerase ERp57.
16428306 2005 Cooperation of ER-60 and BiP in the oxidative refolding of denatured proteins in vitro.
16368681 2006 Domain architecture of protein-disulfide isomerase facilitates its dual role as an oxidase and an isomerase in Ero1p-mediated disulfide formation.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16258833 2005 NMR assignment of the N-terminal domain a of the glycoprotein chaperone ERp57.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16193070 2005 Tapasin and ERp57 form a stable disulfide-linked dimer within the MHC class I peptide-loading complex.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
16002696 2005 Calnexin and ERp57 facilitate the assembly of the neonatal Fc receptor for IgG with beta 2-microglobulin in the endoplasmic reticulum.
15952740 Protein profiling of human pancreatic islets by two-dimensional gel electrophoresis and mass spectrometry.
15896298 2005 In cerebrospinal fluid ER chaperones ERp57 and calreticulin bind beta-amyloid.
15862831 Identification and characterization of 1,25D3-membrane-associated rapid response, steroid (1,25D3-MARRS)-binding protein in rat IEC-6 cells.
15606899 2005 Beta-amyloid protein converting enzyme 1 and brain-specific type II membrane protein BRI3: binding partners processed by furin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451439 2004 ERp57 is present in STAT3-DNA complexes.
15328618 2004 Influence of the oxidoreductase ER57 on the folding of an antibody fab fragment.
15236594 2004 ER-60 domains responsible for interaction with calnexin and calreticulin.
14871899 2004 The primary substrate binding site in the b' domain of ERp57 is adapted for endoplasmic reticulum lectin association.
14871896 2004 ERp57 is a multifunctional thiol-disulfide oxidoreductase.
14732712 2004 Identification and characterization of structural domains of human ERp57: association with calreticulin requires several domains.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12643545 Proteomic analysis of early melanosomes: identification of novel melanosomal proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12239218 2002 Calnexin, calreticulin, and ERp57 cooperate in disulfide bond formation in human CD1d heavy chain.
12235131 2002 Identification of specific glycoforms of major histocompatibility complex class I heavy chains suggests that class I peptide loading is an adaptation of the quality control pathway involving calreticulin and ERp57.
12162574 2002 Transglutaminase activity of human ER-60.
12060494 2002 Association of the chaperone glucose-regulated protein 58 (GRP58/ER-60/ERp57) with Stat3 in cytosol and plasma membrane complexes.
12032078 2002 The oxidoreductase ERp57 efficiently reduces partially folded in preference to fully folded MHC class I molecules.
11842220 2002 TROSY-NMR reveals interaction between ERp57 and the tip of the calreticulin P-domain.
11840567 2002 Cluster analysis of an extensive human breast cancer cell line protein expression map database.
11832422 2002 Interaction with grp58 increases activity of the thiazide-sensitive Na-Cl cotransporter.
10929008 2000 The heterodimeric structure of glucosidase II is required for its activity, solubility, and localization in vivo.
10508608 1999 Nucleotide binding by TAP mediates association with peptide and release of assembled MHC class I molecules.
10436013 1999 ERp57 functions as a subunit of specific complexes formed with the ER lectins calreticulin and calnexin.
9545232 1998 ER-60, a chaperone with thiol-dependent reductase activity involved in MHC class I assembly.
9399589 1997 Functions of characteristic Cys-Gly-His-Cys (CGHC) and Gln-Glu-Asp-Leu (QEDL) motifs of microsomal ER-60 protease.
9205111 1997 Structures of the human gene for the protein disulfide isomerase-related polypeptide ERp60 and a processed gene and assignment of these genes to 15q15 and 1q21.
9153243 1997 The thiol-dependent reductase ERp57 interacts specifically with N-glycosylated integral membrane proteins.
9150948 A two-dimensional gel database of human colon carcinoma proteins.
9150946 Two-dimensional electrophoretic analysis of human breast carcinoma proteins: mapping of proteins that bind to the SH3 domain of mixed lineage kinase MLK2.
8974399 1997 Interaction of the thiol-dependent reductase ERp57 with nascent glycoproteins.
8805302 1996 Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP.
8687406 1996 ERp60 does not substitute for protein disulphide isomerase as the beta-subunit of prolyl 4-hydroxylase.
8624847 1996 Cloning, expression and genomic organization of human placental protein disulfide isomerase (previously identified as phospholipase C alpha).
8529662 1995 Molecular cloning of the human glucose-regulated protein ERp57/GRP58, a thiol-dependent reductase. Identification of its secretory form and inducible expression by the oncogenic transformation.
7945384 1994 Molecular cloning and characterization of a cDNA for bovine phospholipase C-alpha: proposal of redesignation of phospholipase C-alpha.
7487104 1995 cDNA cloning and baculovirus expression of the human liver endoplasmic reticulum P58: characterization as a protein disulfide isomerase isoform, but not as a protease or a carnitine acyltransferase.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1286669 1992 Human liver protein map: a reference database established by microsequencing and gel comparison.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.