Property Summary

NCBI Gene PubMed Count 78
PubMed Score 204.18
PubTator Score 96.80

Knowledge Summary


No data available


  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Pyruvate decarboxylase deficiency 16 6.679 3.3
Disease Target Count Z-score Confidence
Lactic acidosis 51 5.172 2.6
Coffin-Lowry syndrome 9 3.692 1.8


  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.064 1.5e-03
astrocytic glioma -1.200 2.4e-02
ductal carcinoma in situ -1.100 1.5e-03
glioblastoma -1.100 9.4e-04
intraductal papillary-mucinous neoplasm ... 1.100 4.1e-03
invasive ductal carcinoma -1.100 1.1e-02
Multiple myeloma 1.140 5.3e-04
osteosarcoma -1.339 6.0e-04
ovarian cancer 1.600 1.4e-03
Pick disease -1.100 3.8e-05


Accession P08559 A5YVE9 B2R5P7 B7Z3T7 B7Z3X5 Q53H41 Q5JPT8 Q9NP12 Q9UBJ8 Q9UBU0 Q9UNG4 Q9UNG5
Symbols PDHA


PANTHER Protein Class (2)

Protein-protein Interaction (1)

Gene RIF (33)

AA Sequence

QFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVS                                  351 - 390

Text Mined References (97)

PMID Year Title