Property Summary

NCBI Gene PubMed Count 60
PubMed Score 111.42
PubTator Score 60.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma -2.574 1.1e-03
aldosterone-producing adenoma -1.370 2.2e-02
Atopic dermatitis -1.900 1.7e-03
atypical teratoid / rhabdoid tumor 1.400 3.5e-04
autosomal dominant Emery-Dreifuss muscul... 1.149 6.1e-03
Breast cancer -2.600 1.4e-10
breast carcinoma -1.700 1.7e-30
Chronic Lymphocytic Leukemia 2.182 1.8e-04
ductal carcinoma in situ -1.200 1.0e-02
gastric carcinoma -1.200 3.1e-02
group 4 medulloblastoma -1.500 4.9e-04
interstitial cystitis -1.300 3.5e-03
intraductal papillary-mucinous adenoma (... -1.700 1.4e-03
intraductal papillary-mucinous carcinoma... -2.300 3.9e-02
intraductal papillary-mucinous neoplasm ... -3.200 6.0e-04
invasive ductal carcinoma -1.710 6.1e-04
lung cancer -1.200 2.2e-04
lung carcinoma 1.100 1.1e-03
malignant mesothelioma -2.000 1.2e-04
nephrosclerosis 1.443 1.1e-04
oligodendroglioma -2.000 7.4e-03
osteosarcoma 1.799 1.6e-02
ovarian cancer -5.800 5.6e-22
psoriasis -1.900 1.0e-04
tuberculosis 1.300 3.4e-04
type I diabetes mellitus -1.168 1.3e-02
urothelial carcinoma 1.800 5.4e-03

Gene RIF (46)

AA Sequence

MHRLIFVYTLICANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFP      1 - 70
NSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDISETSTIIRGRWCGHKEVPPRI     71 - 140
KSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASETNWESVTSSISGVSYNSPSVTDPTLIADAL    141 - 210
DKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVN    211 - 280
IREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALV    281 - 350
DIQLDHHERCDCICSSRPPR                                                      351 - 370
//

Text Mined References (64)

PMID Year Title