Property Summary

NCBI Gene PubMed Count 52
PubMed Score 113.49
PubTator Score 73.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
psoriasis -1.600 8.3e-07
astrocytoma 1.100 9.9e-12
glioblastoma 2.300 1.2e-03
oligodendroglioma 1.100 4.6e-07
osteosarcoma 3.705 1.9e-05
ependymoma 1.200 9.7e-04
group 4 medulloblastoma 2.000 1.0e-03
cystic fibrosis 1.504 3.4e-05
atypical teratoid / rhabdoid tumor 1.600 5.1e-03
primitive neuroectodermal tumor 1.100 4.9e-02
autosomal dominant Emery-Dreifuss muscul... 1.189 1.9e-02
Amyotrophic Lateral Sclerosis 1.489 2.0e-05
acute quadriplegic myopathy 1.426 3.1e-04
primary pancreatic ductal adenocarcinoma 1.783 7.2e-03
intraductal papillary-mucinous carcinoma... -2.800 1.1e-02
lung cancer 1.300 8.7e-03
active Crohn's disease -1.626 8.5e-03
active ulcerative colitis -2.388 4.6e-03
adult high grade glioma 1.600 3.8e-03
pilocytic astrocytoma 2.300 2.3e-08
aldosterone-producing adenoma -1.515 4.4e-02
Breast cancer -1.900 5.9e-09
invasive ductal carcinoma 1.754 5.9e-03
lung carcinoma -1.400 2.6e-12
ductal carcinoma in situ -1.100 2.0e-03
ovarian cancer -2.900 1.7e-07
pancreatic cancer 1.800 4.6e-03
dermatomyositis 1.200 9.9e-03

Gene RIF (41)

PMID Text
27033449 High glucose-mediated induction of PDGF-C via ChREBP in mesangial cells contributes to the development of glomerular mesangial expansion in diabetes.
26687981 We conclude that PDGF-CC-induced blood-spinal cord barrier dysfunction can contribute to timing of amyotrophic lateral sclerosis onset
25383675 PDGF-C up-regulation was mediated by the human embryonic lethal abnormal vision-like protein HuR, which stabilizes the PDGF-C transcript by binding to two predicted AU-rich elements (AREs) in the 3'-untranslated region (3'-UTR).
24612214 Concomitant upregulation of PDGF-C with VEGF in Glioblastoma tumor cells.
24421315 Platelet-derived growth factor-C (PDGF-C) induces anti-apoptotic effects on macrophages through Akt and Bad phosphorylation.
24269585 Data indicate uPA (plau) and PAI1 (Serpine1) were up-regulated in human PDGF-C Tg mice, suggesting that uPA could be compensating for the loss of tissue-type plasminogen activator (tPA) activity in PDGF-C Tg; tpa KO mice.
24126726 The results indicate that PDGF-C upregulation and calpain-3 downregulation are involved in the aggressiveness of malignant melanoma and suggest that modulators of these proteins
23929039 High PDGF-C expression induces progressive fibrosis, chronic inflammation, neoangiogenesis and sinusoidal congestion resulting in hepatocellular carcinoma.
23784143 Treatment of human neuroblastoma cells or rat primary neurons with HIV-1 Tat downregulates PDGF-C expression
23714575 PDGF-C is both angiogenic and a neuronal survival factor, and it is an important component of neurovascular crosstalk. [Review]
23182716 Results indicate that the alpha-SMA inducing effect of M2 macrophages is in part mediated by secretion of PGDF-CC.
23077641 Treatment of human neuroblastoma cells or rat primary neurons with HIV-1 Tat downregulates PDGF-C expression
23029525 Single nucleotide polymorphisms in the PDGF-C gene are linked to the development of oral clefts.
22035541 Platelet-derived growth factor-C (PDGF-C) activation by serine proteases.
21993555 Melanoma cell-derived platelet-derived growth factor (PDGF)-AA and PDGF-CC were identified as major mediators that signal through PDGFR-alpha and thus induce HAS2-mediated HA synthesis in fibroblasts
21118967 Data suggest that the variant rs1425486 genotype could differentially affect targeting by miR-425 in ovarian cancer cells leading to higher PDGFC expression.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
19968886 PDGFC mRNA expression were down-regulated in biopsies containing infiltrated lymphocytes or thyroiditis.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19569180 Data suggest that five novel genes, LUM, PDE3B, PDGF-C, NRG1 and PKD2, have great potential for predicting the efficacy of cisplatin-based chemotherapy against OSCC.
19553600 Upregulation of PDGFC expression may contribute to the clonal expansion of fibroid-derived smooth muscle cells in the development of uterine fibroids.
19111878 some tumors may overcome inhibition of VEGF-mediated angiogenesis through upregulation of PDGF-C
19092777 The PDGF-C regulatory region SNP rs28999109 decreases promoter transcriptional activity and is associated with cleft lip with or without cleft palate (CL/P)
19092777 Observational study of gene-disease association. (HuGE Navigator)
18588873 A novel splice variant of human PDGF-C (PDGF-Cb), which encodes an N-terminally truncated protein, lacking the signal peptide and CUB domain, is reported.
18573494 PDGF-C and PDGF-D, like PDGF-A and PDGF-B, play important roles in atherosclerosis by stimulating MMP activity and influencing monocyte migration
17482170 Expression of PDGF-C in leiomyomata was significantly higher (approximately 2.4-fold) than in the adjacent normal myometrium.
15911618 determine the molecular mechanism of tPA-mediated activation of PDGF-C dimer
15728360 PDGF-C transgenic mice represent a unique model for the study of hepatic fibrosis progressing to tumorigenesis
15389578 Plays a role in tissue remodeling.
15061151 In adult human tissues, PDGF-C was largely in smooth muscle. It binds & activate alpha PDGFR, & activates beta PDGFR when it is co-expressed with alpha PDGFR through heterodimer formation. PDGF C is likely to play a role in platelet biology.
12707385 PDGF-C is constitutively expressed in the human kidney and is upregulated in podocytes and interstitial cells after injury/activation of these cells.
12598536 PDGF-C has a higher structural homology to the vascular endothelial growth factor than to PDGF-B
12176024 determination of PDGFC expression levels in medulloblastoma tumor cell lines
12032822 Dominant negative PDGF-C inhibits growth of Ewing family tumor cell lines.
11313995 PDGFC was identified as target of EWS/ETS transcriptionalderegulation specific to EWS/FLI-1 chimeras in the Ewing Family Tumors suggesting that it may be a significant mediator of EWS/FLI driven oncogenesis.

AA Sequence

MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRN      1 - 70
TVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQI     71 - 140
RIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQL    141 - 210
DLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRC    211 - 280
GGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG         281 - 345
//

Text Mined References (62)

PMID Year Title
27033449 2016 High glucose induces platelet-derived growth factor-C via carbohydrate response element-binding protein in glomerular mesangial cells.
26687981 2016 Presymptomatic activation of the PDGF-CC pathway accelerates onset of ALS neurodegeneration.
25383675 2014 Post-transcriptional up-regulation of PDGF-C by HuR in advanced and stressed breast cancer.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24612214 2014 Angiogenesis and expression of PDGF-C, VEGF, CD105 and HIF-1? in human glioblastoma.
24421315 2014 Platelet-derived growth factor-C (PDGF-C) induces anti-apoptotic effects on macrophages through Akt and Bad phosphorylation.
24269585 2014 Tissue-type plasminogen activator is not necessary for platelet-derived growth factor-c activation.
24126726 2013 Platelet-derived growth factor C and calpain-3 are modulators of human melanoma cell invasiveness.
23929039 2014 Paracrine activation of hepatic stellate cells in platelet-derived growth factor C transgenic mice: evidence for stromal induction of hepatocellular carcinoma.
23714575 2013 PDGF-C: a new performer in the neurovascular interplay.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23182716 2013 Platelet derived growth factor-CC secreted by M2 macrophages induces alpha-smooth muscle actin expression by dermal and gingival fibroblasts.
23029525 2012 Maternal transmission effect of a PDGF-C SNP on nonsyndromic cleft lip with or without palate from a Chinese population.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22035541 2012 Platelet-derived growth factor-C (PDGF-C) activation by serine proteases: implications for breast cancer progression.
21993555 2012 Melanoma cells control HA synthesis in peritumoral fibroblasts via PDGF-AA and PDGF-CC: impact on melanoma cell proliferation.
21118967 2010 Genetic variants in MicroRNA biosynthesis pathways and binding sites modify ovarian cancer risk, survival, and treatment response.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
19968886 2009 Inverse correlation between PDGFC expression and lymphocyte infiltration in human papillary thyroid carcinomas.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19786962 2011 First genome-wide association scan on neurophysiological endophenotypes points to trans-regulation effects on SLC2A3 in dyslexic children.
19569180 2010 Identification of cisplatin-resistance related genes in head and neck squamous cell carcinoma.
19553600 2009 Platelet-derived growth factor C is upregulated in human uterine fibroids and regulates uterine smooth muscle cell growth.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19111878 2009 PDGF-C mediates the angiogenic and tumorigenic properties of fibroblasts associated with tumors refractory to anti-VEGF treatment.
19092777 2009 The PDGF-C regulatory region SNP rs28999109 decreases promoter transcriptional activity and is associated with CL/P.
18588873 2008 Identification and expression analysis of an N-terminally truncated isoform of human PDGF-C.
18573494 2009 Effects of PDGF-C and PDGF-D on monocyte migration and MMP-2 and MMP-9 expression.
18172073 2008 Plasmin is the major protease responsible for processing PDGF-C in the vitreous of patients with proliferative vitreoretinopathy.
18055825 2007 PDGF-C and -D induced proliferation/migration of human RPE is abolished by inflammatory cytokines.
17482170 2008 Increased expression of platelet-derived growth factor C messenger ribonucleic acid in uterine leiomyomata.
16443219 2006 Nuclear localisation of endogenous SUMO-1-modified PDGF-C in human thyroid tissue and cell lines.
16439802 2006 Fibroblast growth factor 2 and transforming growth factor beta1 synergism in human bronchial smooth muscle cell proliferation.
16279938 2005 Structural and functional specificities of PDGF-C and PDGF-D, the novel members of the platelet-derived growth factors family.
15911618 2005 Structural requirements for activation of latent platelet-derived growth factor CC by tissue plasminogen activator.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15728360 2005 Platelet-derived growth factor C induces liver fibrosis, steatosis, and hepatocellular carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15389578 2005 Regulation of fibrogenic/fibrolytic genes by platelet-derived growth factor C, a novel growth factor, in human dermal fibroblasts.
15372073 2004 Tissue plasminogen activator is a potent activator of PDGF-CC.
15247255 2004 Fibroblast growth factor-2 induction of platelet-derived growth factor-C chain transcription in vascular smooth muscle cells is ERK-dependent but not JNK-dependent and mediated by Egr-1.
15207811 2004 The PDGF family: four gene products form five dimeric isoforms.
15061151 2004 PDGF C is a selective alpha platelet-derived growth factor receptor agonist that is highly expressed in platelet alpha granules and vascular smooth muscle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12707385 2003 PDGF-C expression in the developing and normal adult human kidney and in glomerular diseases.
12598536 2003 Platelet-derived growth factor (PDGF)-C, a PDGF family member with a vascular endothelial growth factor-like structure.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176024 2002 Platelet-derived growth factor-B and -C and active alpha-receptors in medulloblastoma cells.
12032822 2002 Dominant negative PDGF-C inhibits growth of Ewing family tumor cell lines.
11854040 2002 Characterization of platelet-derived growth factor-C (PDGF-C): expression in normal and tumor cells, biological activity and chromosomal localization.
11342471 2001 Chromosomal location, exon structure, and vascular expression patterns of the human PDGFC and PDGFD genes.
11313995 2001 PDGF-C is an EWS/FLI induced transforming growth factor in Ewing family tumors.
11297552 2001 Platelet-derived growth factor C (PDGF-C), a novel growth factor that binds to PDGF alpha and beta receptor.
11004490 2000 Identification of a novel platelet-derived growth factor-like gene, fallotein, in the human reproductive tract.
10858496 2000 A novel gene derived from developing spinal cords, SCDGF, is a unique member of the PDGF/VEGF family.
10806482 2000 PDGF-C is a new protease-activated ligand for the PDGF alpha-receptor.