Property Summary

NCBI Gene PubMed Count 142
PubMed Score 508.99
PubTator Score 336.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
pancreatic cancer 1.100 1.2e-03
malignant mesothelioma 3.100 1.5e-07
astrocytic glioma -2.400 1.4e-02
oligodendroglioma -2.100 2.9e-02
esophageal adenocarcinoma 1.300 2.9e-02
psoriasis -3.900 2.7e-05
osteosarcoma 2.835 3.5e-06
group 4 medulloblastoma -3.000 5.4e-08
cystic fibrosis 1.132 8.9e-05
glioblastoma 1.100 3.1e-02
atypical teratoid / rhabdoid tumor -1.800 4.0e-06
medulloblastoma, large-cell -2.600 1.5e-04
pancreatic ductal adenocarcinoma liver m... 1.401 8.6e-03
intraductal papillary-mucinous adenoma (... 1.300 1.1e-02
Hydrolethalus syndrome 1.808 1.2e-02
lung cancer -3.300 1.7e-06
fibroadenoma 1.600 1.0e-02
lung adenocarcinoma -1.100 1.0e-11
pancreatic carcinoma 1.100 1.2e-03
Breast cancer -2.900 4.7e-08
breast carcinoma -1.700 2.5e-25
ovarian cancer 2.400 1.4e-07

Gene RIF (92)

PMID Text
27010479 These findings implicate DNA hypomethylation as a specific factor in mediating overexpression of genes associated with Biliary Atresia (BA) and identify PDGFA as a new candidate in BA pathogenesis.
27002148 in primary cultures of glioma stemlike cells that EGR1 contributes to stemness marker expression and proliferation by orchestrating a PDGFA-dependent growth-stimulatory loop.
26841646 There was evidence for the involvement of PDGF, IGF-1, and EGF in primary pulmonary hypoplasia. PDGF deficiency plays a certain role in secondary pulmonary hypoplasia
26769046 PDGF-AA impairs endothelium-dependent vasodilation and PDGF-AA mediates BMP4-induced adverse effect on endothelial cell function through SMAD1/5- and SMAD4-dependent mechanisms.
26535645 The development and severity of age-related cataracts was related to the secretion and expression of PDGF-alpha.
26420039 Human uPAR activation and its association with beta1-integrin are required for PDGF-AB-induced migration.
26088859 PDGF and TGFbeta1 regulate acute respiratory distress syndrome-associated lung fibrosis through distinct signaling pathway-mediated activation of fibrosis-related proteins.
25869208 Demonstrate a novel positive regulatory feedback loop between FoxM1 and the PDGF-A/AKT signaling pathway, which contributes to breast cancer cell growth and tumorigenesis.
25832656 our findings showed how FoxM1 activates expression of PDGF-A and STAT3 in a pathway required to maintain the self-renewal and tumorigenicity of glioma stem-like cells.
25767870 MIC-1 and PDGF-A expression is elevated in both prostate tumors and structurally intact adjacent tissues.
25686533 Silencing the Col4-alpha1 gene or disrupting integrin engagement by blocking the antibody reduced the expression of platelet-derived growth factor A (PDGF-A), a potent chemotactic factor for fibroblasts.
25429785 Proprotein convertase 5/6 cleaves PDGFA in the human endometrium in preparation for embryo implantation.
25379550 VEGF, PDGF, and TGF-beta1 concentrations in platelets may be associated with prognosis of breast cancer.
25140996 Patients with Graves ophthalmopathy had significantly higher serum levels of PDGF-AA than controls. Immunosuppressive therapy removed differences.
25092176 PDGFA is a SOX11 direct target gene upregulated in MCL cells whose inhibition impaired SOX11-enhanced in vitro angiogenic effects on endothelial cells
25085844 AVP stimulates myofibroblast proliferation and induces PDGFA secretion, implying that PDGFA mediates local myofibroblast proliferation by an autocrine feedback loop and regulates epithelial proliferation and permeability by a paracrine mechanism.
24995287 both VEGF and PDGF were significantly downregulated after completing a full CMP rush IgE desensitization.
24480986 demonstrated that PDGFRA activation supported tumor cell proliferation
24454980 The suppressive effects of PDGF-BB on Ca(2+) overload in neurons were more potent than those of PDGF-AA.
24378341 PDGF positively modulates the TGF-beta-induced osteogenic differentiation of hMSCs through synergistic crosstalk between MEK- and PI3K/Akt-mediated signaling
23944365 review elucidates the role of tumor stroma interactions, the roles of PDGF receptor signaling in cancer-associated fibroblasts via alteration of stromal matrix composition and the mitogenic effects of cancer-derived PDGFs.
23620752 The mRNA expressions of the proangiogenic growth factors VEGF, PDGF, bFGF and their receptors (VEGFR1, VEGFR2, PDGFRA, PDGFRB, FGFR1, FGFR2) were measured and compared in gastric ulcers of cirrhotic patients.
23536282 Platelet-derived growth factor-A and vascular endothelial growth factor-C might induce intimal proliferation in pulmonary arteries and contribute to the development of pulmonary tumor thrombotic microangiopathy.
23025904 show that VEGF was down-regulated while platelet-derived growth factor-A (PDGF-A) was up-regulated when IFN-alpha treatment was re-initiated.
22964636 our studies establish that loss of SMAD1/5 leads to upregulation of PDGFA in ovarian granulosa cells
22949635 Pdgf signaling potentiates Wnt2-Wnt7b signaling to promote high levels of Wnt activity in mesenchymal progenitors that is required for proper development of endoderm-derived organs, such as the lung
22733151 Results suggest that PDGFA may be used for cholangiocarcinoma prognosis and/or as diagnostic candidate marker.
22704695 Findings suggest a role for brain derived neurotropic factor (BDNF) and platelet derived growth factors PDGF-AA in the patho-physiological mechanism of cerebrovascular disease in sickle cell anemia (SCA).
22617683 The kidney takes part in the elimination of IL-6 and PDGF from systemic circulation. The kidney does not take part in the elimination of TGF-beta.
22588000 Somatostatin and somatostatin analogues reduce PDGF-induced endometrial cell proliferation and motility
22393407 analysis of astrocyte-specific expression patterns associated with the PDGF-induced glioma microenvironment
22266848 MUC1-induced invasion and proliferation occurs via increased exogenous production of PDGFA in pancreatic ductal carcinoma.
22174424 Report increased PDGF-A, PDGF-B and FGF-2 expression in recurrence of salivary gland pleomorphic adenoma.
21993555 Melanoma cell-derived platelet-derived growth factor (PDGF)-AA and PDGF-CC were identified as major mediators that signal through PDGFR-alpha and thus induce HAS2-mediated HA synthesis in fibroblasts
21931722 analysis of the cell of origin of NF1- and PDGF-driven glioblastomas
21919032 Significant positive correlation was seen between serum PDGF-AB & microvascular density in multiple myeloma, & between pre- & post-treatment patients. PDGF-AB plays a role in a complex cytokine network inducing bone marrow neovascularization.
21906875 BRAF mutations were found in 3 of 87 gastrointestinal stromal tumors.
21771201 Our study was the first to show that CSF PDGF-AA is related to disease duration in relapsing-remitting multiple sclerosis.
21769672 Studies suggest that various isoforms of PDGF bind with differential affinities to two related tyrosine kinase receptors, denoted the PDGF alpha- and beta-receptors.
21645144 PDGF and PDGFR-alpha may be involved in the pathophysiology of the human thymus.
21559523 TMEFF2 can function to regulate PDGF signaling; it is hypermethylated and downregulated in glioma and several other cancers
21187969 the serum-induced increase in cell surface GLUT4 levels is not due to inhibition of its internalization and is not mediated by insulin, PDGF, IGF-1, or HGF
20822908 arteriovenous malformation had higher levels of PDGF-A expression than cerebral cavernous malformation
20730440 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20534510 analysis of the conserved, hydrophobic association mode of PDGF-A/propeptide complex
20485444 Observational study of gene-disease association. (HuGE Navigator)
20224347 adipose tissue-derived stem cells have the capacity to differentiate into capillary structures and platelet-derived growth factor alpha plays a critical role in this process.
20220555 PDGF-alpha diminished human adipose-derived stromal cell adipogenesis.
20202860 Three of four angiogenic factors, VEGF, b-FGF and IGF-I, are higher concentration in human milk which collected from preterm mothers than those of terms.
20083221 data suggest that advanced glycation end product(AGE)-modification of PDGF contributes to reduced wound healing in diabetic patients
20036815 Studies indicate that the imbalance of pro-angiogenic and anti-angiogenic factors VEGFA, Notch, Dll4, PDGF and angiopoietin-1 promotes tumor angiogenesis.
20036812 Studies indicate communication between tumor cells and their microenvironment is through polypeptide growth factors EGF, FGF, PDGF and receptors for these growth factors.
19956642 analysis of how an enediynyl peptide inhibitor of furin blocks processing of proPDGF-A, B and proVEGF-C
19707201 concurrent expression of PDGFA and PDGFRA in different subtypes of gliomas, reinforce the recognised significance of this signalling pathway in gliomas.
19559929 Immunohistochemistry for PDGF was found to be useful in differentiating various grades of oligodendroglioma, and therefore, it may be involved in tumor cell proliferation and malignant transformation.
19493486 SiO(2) may affect the expression of PDGF and synthesis of collagen through alveolar macrophage mediation and participate in the formation of lung fibrosis.
19141566 A novel PDGF response in human preadipocytes that involves the pro-inflammatory kinase IKKbeta and demonstrate that it is required for the inhibition of adipogenesis.
18992915 We showed that Prx I, PDGF-A, and PDGFR-alpha follow the same expression pattern during carcinoma ex pleomorphic adenoma progression.
18814141 OPG production by osteoblastic cells was stimulated by platelet-derived growth factor (PDGF) in two human osteosarcoma cell lines (MG63, Saos-2), a mouse pre-osteoblastic cell line (MC3T3-E1) and human bone marrow stromal cells (hMSC).
18808740 Results describe significant differences between controls and patients with renal cell carcinoma both pre-operatively and post-operatively in angiogenin, PDGF and MCP-1 serum levels.
18592007 Measuring PDGFA, bFGF, and HIF1a expression may contribute to a better understanding of the prognosis of patients with pancreatic cancer.
18332228 identified activin-mediated transforming growth factor (TGF)-beta signaling, platelet-derived growth factor (PDGF) signaling and fibroblast growth factor (FGF) signaling as the key pathways involved in MSC differentiation
18326546 The proteins for PDGF-A were detected in oocytes, and in granulosa cells (GC) of 50% of the follicles from women/girls.
18284546 regularly expressed in variable levels in ameloblastomas
18174235 tumor cell-secreted platelet-derived growth factor (PDGF) and phosphoinositide 3-kinase (PI3K) activation have roles in resistance of fibroblasts against oxidative damage
18084257 PDGFRs and the PDGF-A chain are frequently expressed in ovarian clear-cell adenocarcinomas.
17984069 Ligand-mediated stabilization of G-quadruplex structures within the PDGF-A nuclease hypersensitive element can silence PDGF-A expression.
17958740 thrombin may play an important role in the proliferation of A172 cells by inducing PDGF-AB secretion and that thrombin's action is mediated by its proteolytic activity
17944929 Increased expression of PDGF/Ralphabeta may play an important role in the mechanism of growth of...paediatric fibromatous lesions
17933214 Tretinoin inducibility of PDGFA is mediated by 5'-distal DNA motifs that overlap with basal enhancer and vitamin D response elements.
17852407 FGF and PDGF have roles in cell proliferation and migration in osteoblastic cells
17578349 expression level might be decreased during the secretory phase in the eutopic endometrium of women with advanced stage endometriosis
17087110 During the wound healing of nasal mucosa, the levels of PDGF, TNF-alpha, and hyaluronic acid are different at each postoperative stage.
16850112 36% of the examined primary central nervous system lymphoma specimens showed expression of PDGF-A. Tumours expressing survivin occasionally co-expressed PDGF-A.
16760468 JNK is a critical component downstream of PI 3-kinase that may be involved in PDGF-stimulated chemotaxis presumably by modulating the integrity of focal adhesions by phosphorylating its components
15890262 thrombospondin-1 is not necessary for proliferation but is permissive for vascular smooth muscle cell responses to platelet-derived growth factor
15857508 HIV-1 Tat upregulates members of the PDGF/VEGF growth factor family (PDGFA, VEGFA,VEGFB, VEGFC) in mammary epithelial cells
15829977 These results identify a novel mechanism of transcriptional enhancement involving ligand-independent activity of the VDR/RXR heterodimer and MAPK signaling pathways
15631865 The PDGF expression, as a marker of angiogenesis, was evaluated in myomas obtained after surgery.
14997209 PDGFA autocrine inhibition is associated with malignant gliomas
14708943 PDGF-A is a novel mitogenic target of 1,25-(OH)2D3 whose expression is induced via binding of hormone-activated VDR to a response element located far upstream of the transcription start site
14705808 cultured follicular keratinocytes synthesize both PDGF-A and PDGF-B, whereas, dermal papilla cells only express PDGF-A.
14633628 Glucose causes a late increase in PDGF-dependent TGF-beta 1 translation by enhancing cellular sensitivity to PDGF.
14573617 PDGF-A chain gene expression, under the control of KLF5, is cooperatively activated by the NF-kappaB p50 subunit and a pathophysiological stimulus.
12972619 PDGF1 potently activates AP-1 ands causes cellular neoplastic transformation.
12850832 a time-dependent release of TGFB and PDGF-AB occurred at neutral and alkaline pH, but not pH5, 15 min and 12h after platelet activation, suggesting relevance to wound healing
12670444 PDGF up-regulates the expression of transcription factors NF-E2, GATA-1 and c-Fos in megakaryocytic cell lines
12645527 PDGF has a role in inducing beta-gamma-secretase-mediated cleavage of Alzheimer's amyloid precursor protein through a Src-Rac-dependent pathway
12615918 The preferential formation of disulfide-bonded heterodimers from an equimolar mixture of unfolded A- and B-chains is thus a kinetically controlled process
12576295 PDGF and similar cytokines may be important factors in airway remodeling by redistribution of smooth muscle cells during inflammation and that urokinase may be important in potentiating the response.
12411321 involvement of Furin gene regulation in the maturation of PDGF-AB in differentiating megakaryoblastic cells
11678848 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRTLACLLLLGCGYLAHVLAEEAEIPREVIERLARSQIHSIRDLQRLLEIDSVGSEDSLDTSLRAHGVHA      1 - 70
TKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKC     71 - 140
QPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKP    141 - 210
T//

Text Mined References (145)

PMID Year Title
27010479 2016 Methylation Microarray Studies Highlight PDGFA Expression as a Factor in Biliary Atresia.
27002148 2016 A Positive Feed-forward Loop Associating EGR1 and PDGFA Promotes Proliferation and Self-renewal in Glioblastoma Stem Cells.
26841646 [Immunohistochemical changes in the lungs from fetuses and newborn infants at 20- 40 weeks' gestation with false left-sided congenital diaphragmatic hernia].
26769046 2016 Bone Morphogenic Protein 4-Smad-Induced Upregulation of Platelet-Derived Growth Factor AA Impairs Endothelial Function.
26535645 2015 Expression and function of PDGF-? in columnar epithelial cells of age-related cataracts patients.
26420039 2015 Urokinase-type plasminogen activator receptor interaction with ?1 integrin is required for platelet-derived growth factor-AB-induced human mesenchymal stem/stromal cell migration.
26088859 2015 Platelet-Derived Growth Factor and Transforming Growth Factor ?1 Regulate ARDS-Associated Lung Fibrosis Through Distinct Signaling Pathways.
25869208 2015 FoxM1 promotes breast tumorigenesis by activating PDGF-A and forming a positive feedback loop with the PDGF/AKT signaling pathway.
25832656 2015 FoxM1 Drives a Feed-Forward STAT3-Activation Signaling Loop That Promotes the Self-Renewal and Tumorigenicity of Glioblastoma Stem-like Cells.
25767870 2015 Prostate field cancerization: deregulated expression of macrophage inhibitory cytokine 1 (MIC-1) and platelet derived growth factor A (PDGF-A) in tumor adjacent tissue.
25686533 2015 Dependence of fibroblast infiltration in tumor stroma on type IV collagen-initiated integrin signal through induction of platelet-derived growth factor.
25429785 2015 Proprotein convertase 5/6 cleaves platelet-derived growth factor A in the human endometrium in preparation for embryo implantation.
25379550 2014 Expression of angiogenesis regulatory proteins and epithelial-mesenchymal transition factors in platelets of the breast cancer patients.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25140996 2014 Serum concentration of VEGF and PDGF-AA in patients with active thyroid orbitopathy before and after immunosuppressive therapy.
25092176 2014 SOX11 promotes tumor angiogenesis through transcriptional regulation of PDGFA in mantle cell lymphoma.
25085844 2014 Vasopressin regulation of epithelial colonic proliferation and permeability is mediated by pericryptal platelet-derived growth factor A.
24995287 2014 Downregulation of angiogenesis factors, VEGF and PDGF, after rapid IgE desensitization and oral immunotherapy in children with food allergy.
24703957 2014 PDGF receptor signaling networks in normal and cancer cells.
24480986 2014 Platelet-derived growth factor alpha mediates the proliferation of peripheral T-cell lymphoma cells via an autocrine regulatory pathway.
24454980 2013 PDGF suppresses oxidative stress induced Ca2+ overload and calpain activation in neurons.
24378341 2014 PDGF-induced PI3K-mediated signaling enhances the TGF-?-induced osteogenic differentiation of human mesenchymal stem cells in a TGF-?-activated MEK-dependent manner.
23944365 2014 PDGF/PDGFR signaling and targeting in cancer growth and progression: Focus on tumor microenvironment and cancer-associated fibroblasts.
23620752 2013 The diminished expression of proangiogenic growth factors and their receptors in gastric ulcers of cirrhotic patients.
23536282 2013 Platelet-derived growth factor-A and vascular endothelial growth factor-C contribute to the development of pulmonary tumor thrombotic microangiopathy in gastric cancer.
23025904 2012 Up-regulation of platelet-derived growth factor-A is responsible for the failure of re-initiated interferon alpha treatment in hepatocellular carcinoma.
22964636 2013 BMP-specific SMADs function as novel repressors of PDGFA and modulate its expression in ovarian granulosa cells and tumors.
22949635 2012 Wnt ligands signal in a cooperative manner to promote foregut organogenesis.
22733151 2012 Platelet-derived growth factor may be a potential diagnostic and prognostic marker for cholangiocarcinoma.
22704695 2012 Plasma BDNF and PDGF-AA levels are associated with high TCD velocity and stroke in children with sickle cell anemia.
22617683 2012 The role of the kidney in the systemic elimination of interleukin 6, platelet-derived growth factor and transforming growth factor beta.
22588000 2012 Somatostatin and somatostatin analogues reduce PDGF-induced endometrial cell proliferation and motility.
22393407 2012 Astrocyte-specific expression patterns associated with the PDGF-induced glioma microenvironment.
22266848 2012 MUC1 regulates PDGFA expression during pancreatic cancer progression.
22174424 2012 The increased PDGF-A, PDGF-B and FGF-2 expression in recurrence of salivary gland pleomorphic adenoma.
21993555 2012 Melanoma cells control HA synthesis in peritumoral fibroblasts via PDGF-AA and PDGF-CC: impact on melanoma cell proliferation.
21931722 2011 The probable cell of origin of NF1- and PDGF-driven glioblastomas.
21919032 2012 Role of platelet-derived growth factor-AB in tumour growth and angiogenesis in relation with other angiogenic cytokines in multiple myeloma.
21906875 2011 Spectrum of KIT/PDGFRA/BRAF mutations and Phosphatidylinositol-3-Kinase pathway gene alterations in gastrointestinal stromal tumors (GIST).
21771201 2012 Serum and CSF PDGF-AA and FGF-2 in relapsing-remitting multiple sclerosis: a case-control study.
21769672 2011 PDGF: the nuts and bolts of signalling toolbox.
21645144 2011 Platelet-derived growth factor and platelet-derived growth factor receptor-? expression in the normal human thymus and thymoma.
21559523 2011 TMEFF2 is a PDGF-AA binding protein with methylation-associated gene silencing in multiple cancer types including glioma.
21187969 2010 A serum factor induces insulin-independent translocation of GLUT4 to the cell surface which is maintained in insulin resistance.
20822908 2010 Expression of platelet-derived growth factor ligand and receptor in cerebral arteriovenous and cavernous malformations.
20730440 2011 Genetic factors responsible for long bone fractures non-union.
20534510 2010 Structures of a platelet-derived growth factor/propeptide complex and a platelet-derived growth factor/receptor complex.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20224347 2010 PDGF and bFGF modulate tube formation in adipose tissue-derived stem cells.
20220555 2010 Regulation of human adipose-derived stromal cell osteogenic differentiation by insulin-like growth factor-1 and platelet-derived growth factor-alpha.
20202860 2010 Vascular endothelial growth factor, basic fibroblast growth factor, insulin-like growth factor-I and platelet-derived growth factor levels in human milk of mothers with term and preterm neonates.
20083221 2010 Glycation of PDGF results in decreased biological activity.
20036815 2010 Regulation of tumor angiogenesis by the local environment.
20036812 2010 Growth factors in tumor microenvironment.
19956642 2009 A novel enediynyl peptide inhibitor of furin that blocks processing of proPDGF-A, B and proVEGF-C.
19707201 2009 Expression, mutation and copy number analysis of platelet-derived growth factor receptor A (PDGFRA) and its ligand PDGFA in gliomas.
19559929 2009 Platelet-derived growth factor expression correlates with tumor grade and proliferative activity in human oligodendrogliomas.
19493486 2009 [Effect of SiO(2) on expression of platelet derived growth factor in human silicotic alveolar macrophages and human embryonic lung fibroblasts].
19141566 2009 IKKbeta and the anti-adipogenic effect of platelet-derived growth factor in human abdominal subcutaneous preadipocytes.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
19019919 2009 PDGF receptor-{beta} modulates metanephric mesenchyme chemotaxis induced by PDGF AA.
18992915 2009 Peroxiredoxin I, platelet-derived growth factor A, and platelet-derived growth factor receptor alpha are overexpressed in carcinoma ex pleomorphic adenoma: association with malignant transformation.
18814141 2009 Platelet-derived growth factor stimulates osteoprotegerin production in osteoblastic cells.
18808740 2008 Determination of angiogenic factors in serum by protein array in patients with renal cell carcinoma.
18592007 2008 High expression of HIF1a is a predictor of clinical outcome in patients with pancreatic ductal adenocarcinomas and correlated to PDGFA, VEGF, and bFGF.
18483217 2008 Role of platelet-derived growth factors in physiology and medicine.
18332228 2008 PDGF, TGF-beta, and FGF signaling is important for differentiation and growth of mesenchymal stem cells (MSCs): transcriptional profiling can identify markers and signaling pathways important in differentiation of MSCs into adipogenic, chondrogenic, and osteogenic lineages.
18326546 2008 Platelet-derived growth factors (PDGF-A and -B) and their receptors in human fetal and adult ovaries.
18284546 2008 Expression of platelet-derived growth factor-AA and platelet-derived growth factor-alpha receptor in ameloblastomas.
18174235 2008 Stromal resistance of fibroblasts against oxidative damage: involvement of tumor cell-secreted platelet-derived growth factor (PDGF) and phosphoinositide 3-kinase (PI3K) activation.
18084257 2008 Expression of platelet-derived growth factors and their receptors in ovarian clear-cell carcinoma and its putative precursors.
17984069 2007 Characterization of the G-quadruplexes in the duplex nuclease hypersensitive element of the PDGF-A promoter and modulation of PDGF-A promoter activity by TMPyP4.
17958740 2007 Thrombin-induced cell proliferation and platelet-derived growth factor-AB release from A172 human glioblastoma cells.
17944929 2007 Platelet-derived growth factor receptors and ligands are up-regulated in paediatric fibromatoses.
17933214 2007 Retinoic acid inducibility of the human PDGF-a gene is mediated by 5'-distal DNA motifs that overlap with basal enhancer and vitamin D response elements.
17852407 2007 Differential effect of FGF and PDGF on cell proliferation and migration in osteoblastic cells.
17578349 2007 Expression of epidermal growth factor, fibroblast growth factor-2, and platelet-derived growth factor-A in the eutopic endometrium of women with endometriosis.
17470632 2007 Vascular endothelial growth factor can signal through platelet-derived growth factor receptors.
17087110 2006 [The correlation of PDGF and TNF-alpha and HA and nasal mucosa healing after ESS].
16850112 2006 Expression of survivin, platelet-derived growth factor A (PDGF-A) and PDGF receptor alpha in primary central nervous system lymphoma.
16760468 2006 c-Jun N-terminal kinase is necessary for platelet-derived growth factor-mediated chemotaxis in primary fibroblasts.
16462734 2006 VEGF-C is a trophic factor for neural progenitors in the vertebrate embryonic brain.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15890262 2005 Endogenous thrombospondin-1 is not necessary for proliferation but is permissive for vascular smooth muscle cell responses to platelet-derived growth factor.
15829977 2005 A 5'-distal enhanceosome in the PDGF-A gene is activated in choriocarcinoma cells via ligand-independent binding of vitamin D receptor and constitutive jun kinase signaling.
15631865 2005 Preoperative administration of GnRH-a plus tibolone to premenopausal women with uterine fibroids: evaluation of the clinical response, the immunohistochemical expression of PDGF, bFGF and VEGF and the vascular pattern.
14997209 2004 Inhibition of platelet-derived growth factor signalling induces autophagy in malignant glioma cells.
14708943 A 5'-distal element mediates vitamin D-inducibility of PDGF-A gene transcription.
14705808 2003 Regulation of PDGF and PDGF receptor in cultured dermal papilla cells and follicular keratinocytes of the human hair follicle.
14633628 2003 Long-term exposure of proximal tubular epithelial cells to glucose induces transforming growth factor-beta 1 synthesis via an autocrine PDGF loop.
14573617 2004 Regulation of platelet-derived growth factor-A chain by Krüppel-like factor 5: new pathway of cooperative activation with nuclear factor-kappaB.
12972619 2003 Phosphorylation of the carboxyl-terminal transactivation domain of c-Fos by extracellular signal-regulated kinase mediates the transcriptional activation of AP-1 and cellular transformation induced by platelet-derived growth factor.
12853948 2003 The DNA sequence of human chromosome 7.
12850832 2003 Time- and pH-dependent release of PDGF and TGF-beta from platelets in vitro.
12670890 2003 The proteolytic processing of pro-platelet-derived growth factor-A at RRKR(86) by members of the proprotein convertase family is functionally correlated to platelet-derived growth factor-A-induced functions and tumorigenicity.
12670444 2003 Platelet-derived growth factor up-regulates the expression of transcription factors NF-E2, GATA-1 and c-Fos in megakaryocytic cell lines.
12645527 2003 Platelet-derived growth factor induces the beta-gamma-secretase-mediated cleavage of Alzheimer's amyloid precursor protein through a Src-Rac-dependent pathway.
12615918 2003 Kinetics control preferential heterodimer formation of platelet-derived growth factor from unfolded A- and B-chains.
12576295 2003 Urokinase potentiates PDGF-induced chemotaxis of human airway smooth muscle cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411321 2002 Furin gene (fur) regulation in differentiating human megakaryoblastic Dami cells: involvement of the proximal GATA recognition motif in the P1 promoter and impact on the maturation of furin substrates.
12070119 2002 Adipocyte-derived plasma protein adiponectin acts as a platelet-derived growth factor-BB-binding protein and regulates growth factor-induced common postreceptor signal in vascular smooth muscle cell.
11994382 2002 Expression of platelet-derived growth factor-A (PDGF-A), PDGF-B, and PDGF receptor-alpha and -beta during human testicular development and disease.
11788434 2002 Effect of platelet-derived growth factor isoforms in rat metanephric mesenchymal cells.
11678848 2001 DNA sequence variants of the platelet-derived growth factor A-chain gene.
10806482 2000 PDGF-C is a new protease-activated ligand for the PDGF alpha-receptor.
10681572 2000 Identical or overlapping sequences in the primary structure of human alpha(2)-macroglobulin are responsible for the binding of nerve growth factor-beta, platelet-derived growth factor-BB, and transforming growth factor-beta.
10598812 1999 Complex patterns of intragenic polymorphism at the PDGFA locus.
10508235 1999 Mechanism of action and in vivo role of platelet-derived growth factor.
10358027 1999 High-affinity binding of basic fibroblast growth factor and platelet-derived growth factor-AA to the core protein of the NG2 proteoglycan.
9837894 1998 Identification of a cell type-specific enhancer in the distal 5'-region of the platelet-derived growth factor A-chain gene.
9739761 1998 Signal transduction via platelet-derived growth factor receptors.
9692901 1998 Mapping of the binding of platelet-derived growth factor to distinct domains of the basement membrane proteins BM-40 and perlecan and distinction from the BM-40 collagen-binding epitope.
9409235 1997 Platelet-derived growth factor beta-receptors can both promote and inhibit chemotaxis in human vascular smooth muscle cells.
8900172 1996 Type I, II, III, IV, V, and VI collagens serve as extracellular ligands for the isoforms of platelet-derived growth factor (AA, BB, and AB).
8780057 1996 Characterization of a novel platelet-derived growth factor-associated protein.
8647855 1996 Modulation of the SH2 binding specificity and kinase activity of Src by tyrosine phosphorylation within its SH2 domain.
8486521 1993 Nucleotide sequence of the 5' region of the human platelet-derived growth factor A-chain gene.
7679113 1993 Mechanism of platelet-derived growth factor (PDGF) AA, AB, and BB binding to alpha and beta PDGF receptor.
7073684 1982 Platelet-derived growth factor: identification of constituent polypeptide chains.
3754619 1986 cDNA sequence and chromosomal localization of human platelet-derived growth factor A-chain and its expression in tumour cell lines.
3666150 1987 The long 3'-untranslated regions of the PDGF-A and -B mRNAs are only distantly related.
3614364 1987 Alternative RNA splicing affects function of encoded platelet-derived growth factor A chain.
3614363 1987 cDNA clones reveal differences between human glial and endothelial cell platelet-derived growth factor A-chains.
3422746 1988 Platelet-derived growth factor A chain: gene structure, chromosomal location, and basis for alternative mRNA splicing.
2842868 1988 Comparison of biological properties and transforming potential of human PDGF-A and PDGF-B chains.
2836953 1988 A common PDGF receptor is activated by homodimeric A and B forms of PDGF.
2832727 1988 Structural characterization of the human platelet-derived growth factor A-chain cDNA and gene: alternative exon usage predicts two different precursor proteins.
2544881 1989 cDNA cloning and expression of the human A-type platelet-derived growth factor (PDGF) receptor establishes structural similarity to the B-type PDGF receptor.
2538439 1989 Collagen-induced binding to human platelets of platelet-derived growth factor leading to inhibition of P43 and P20 phosphorylation.
2536956 1989 Isolation of a novel receptor cDNA establishes the existence of two PDGF receptor genes.
2439522 1987 PDGF induces c-myc mRNA expression in MG-63 human osteosarcoma cells but does not stimulate cell replication.
2315311 1990 Increased platelet-derived growth factor A-chain expression in human uterine smooth muscle cells during the physiologic hypertrophy of pregnancy.
1997274 1991 Expression of platelet-derived growth factor A-chain (PDGF-A) mRNA in lung tissue and cells. Complex regulation during remodeling.
1848007 1991 Promoter region of the human platelet-derived growth factor A-chain gene.
1612586 1992 Platelet-derived growth factor A chain: confirmation of localization of PDGFA to chromosome 7p22 and description of an unusual minisatellite.
1512241 1992 Modulation of transcription of the platelet-derived growth factor A-chain gene by a promoter region sensitive to S1 nuclease.
1505216 1992 The human platelet-derived growth factor alpha chain (PDGFA) gene maps to chromosome 7p22.
1360804 1992 Platelet-derived growth factor (PDGF) A-chain mRNA heterogeneity generated by the use of alternative promoters and alternative polyadenylation sites.
1317862 1992 Assignment of interchain disulfide bonds in platelet-derived growth factor (PDGF) and evidence for agonist activity of monomeric PDGF.
1311092 1992 The extracellular glycoprotein SPARC interacts with platelet-derived growth factor (PDGF)-AB and -BB and inhibits the binding of PDGF to its receptors.
1281549 1992 Expression cloning of a human dual-specificity phosphatase.
612586 1977 Vascular hamartoma and vascular tumours of orbit.
291037 1979 Platelet-derived growth factor: purification and partial characterization.
287022 1979 Purification of human platelet-derived growth factor.