Property Summary

NCBI Gene PubMed Count 23
PubMed Score 20.79
PubTator Score 18.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.300 4.1e-02
osteosarcoma 1.722 2.3e-04
colon cancer -1.300 2.1e-02
group 4 medulloblastoma -2.000 3.2e-04
posterior fossa group A ependymoma 1.200 2.2e-04
Pick disease -2.000 3.3e-04
progressive supranuclear palsy -2.200 1.1e-02
ovarian cancer -1.800 3.0e-06
Down syndrome 1.200 8.0e-03

Protein-protein Interaction (9)

Gene RIF (15)

PMID Text
25295610 PDE8A supports HIV-1 replication in macrophages
25295610 HIV-1 replication is enhanced by PDE8A
25229150 a novel and critical role for phosphodiesterases in moderating local concentrations of cAMP in microdomains and signal resetting
23509299 PDE8A can bind tightly to Raf-1, regulate Raf-1 phosphorylation on S259, and, in so doing, regulate the cross-talk node whereby cAMP exerts an inhibitory effect on Raf-1 signaling, retarding subsequent ERK phosphorylation and activation.
22673573 PDE8 activity can be modulated by a kinase
21920574 Polymorphism in PDE8A affects HIV-1 replication in primary macrophages.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19482904 The findings exclude a significant role for PDE8A as a PCOS candidate gene, and as a Las major determinant of androgen levels in women.
19482904 Observational study of gene-disease association. (HuGE Navigator)
18983167 kinetic properties of the highly active PDE8A1 catalytic domain prepared from refolding and its crystal structures in the unliganded and 3-isobutyl-1-methylxanthine (IBMX) bound forms at 1.9 and 2.1 A resolutions
18976975 HIV-1 replication is enhanced by PDE8A
15596729 in vitro and in vivo experiments demonstrated that the association with IkappaB greatly enhanced the enzyme activity of PDE8A1
12681444 Comparison of enzymatic characterization and gene organization of PDE8B and PDE8A.
11156964 HIV-1 Tat decreases the intracellular levels of cAMP and CREB ser-133 phosphorylation through a signal transduction pathway involving sequential activation of phosphatidylinositol 3-kinase, AKT, and cyclic nucleoside phosphodiesterases

AA Sequence

MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQF      1 - 70
GPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFLDKHHDIIIIDHRNPRQLDA     71 - 140
EALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFISAGFTRRYVENPNIMACYNELLQLEFGEVRSQLK    141 - 210
LRACNSVFTALENSEDAIEITSEDRFIQYANPAFETTMGYQSGELIGKELGEVPINEKKADLLDTINSCI    211 - 280
RIGKEWQGIYYAKKKNGDNIQQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTG    281 - 350
KHKDRRKGSLDVKAVASRATEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLE    351 - 420
ILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQMVSSNIITPISLDDVPPRIAR    421 - 490
AMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRSWLQIIEANYHSSNPYHNSTH    491 - 560
SADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHA    561 - 630
ALAFQLTTGDDKCNIFKNMERNDYRTLRQGIIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKN    631 - 700
QEVINTMLRTPENRTLIKRMLIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRN    701 - 770
TCSIPKSQISFIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRNLRPPPE               771 - 829
//

Text Mined References (28)

PMID Year Title
25295610 2014 Phosphodiesterase 8a supports HIV-1 replication in macrophages at the level of reverse transcription.
25229150 2014 Active site coupling in PDE:PKA complexes promotes resetting of mammalian cAMP signaling.
23568457 2013 Genetic variants associated with disordered eating.
23509299 2013 Phosphodiesterase-8A binds to and regulates Raf-1 kinase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22673573 2012 Cyclic AMP-specific phosphodiesterase, PDE8A1, is activated by protein kinase A-mediated phosphorylation.
21920574 2011 Polymorphism in HIV-1 dependency factor PDE8A affects mRNA level and HIV-1 replication in primary macrophages.
20719862 2010 New loci associated with central cornea thickness include COL5A1, AKAP13 and AVGR8.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19482904 2009 PDE8A genetic variation, polycystic ovary syndrome and androgen levels in women.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18983167 2008 Kinetic and structural studies of phosphodiesterase-8A and implication on the inhibitor selectivity.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15596729 2004 Per-Arnt-Sim domain-dependent association of cAMP-phosphodiesterase 8A1 with IkappaB proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12681444 2003 Comparison of enzymatic characterization and gene organization of cyclic nucleotide phosphodiesterase 8 family in humans.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12045112 2002 RNA editing by adenosine deaminases that act on RNA.
11738832 2001 Human phosphodiesterase 8A splice variants: cloning, gene organization, and tissue distribution.
11371644 2001 T cell activation up-regulates cyclic nucleotide phosphodiesterases 8A1 and 7A3.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
9618252 1998 Isolation and characterization of PDE8A, a novel human cAMP-specific phosphodiesterase.