Property Summary

NCBI Gene PubMed Count 24
PubMed Score 82.59
PubTator Score 65.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

 MGI Phenotype (1)

Protein-protein Interaction (9)

Gene RIF (10)

PMID Text
25128584 PDE7A is a high-speed and low-affinity phosphodiesterase for cCMP.
23661015 PDE7 has roles in regulating oligodendrocyte precursor survival and differentiation during brain development and in adulthood
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18420479 results show that specific gene silencing with the RNAi method is a useful tool for inhibiting the gene expression of specific PDEs and that PDE7 silencing upregulates several osteogenic genes and increases mineralization
15994308 crystal structure of PDE7A1 catalytic domain complexed with the inhibitor 3-isobutyl-1-methylxanthine & kinetic analysis on mutant PDE7A1 and PDE4D2; results show several residues must work together to switch inhibitor selectivity between PDE4 & PDE7
12388353 Ubiquitous expression of phosphodiesterase 7A in human proinflammatory and immune cells; PDE7A was expressed in neutrophils and alveolar macrophages
12067300 PDE7 has the potential to regulate human T cell function including cytokine production, proliferation and expression of activation markers.
11156964 HIV-1 Tat decreases the intracellular levels of cAMP and CREB ser-133 phosphorylation through a signal transduction pathway involving sequential activation of phosphatidylinositol 3-kinase, AKT, and cyclic nucleoside phosphodiesterases

AA Sequence

MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTALYIRMLGDVR      1 - 70
VRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRSSRFFRGTAVSNSLNILDDDY     71 - 140
NGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNP    141 - 210
YHNAVHAADVTQAMHCYLKEPKLANSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSV    211 - 280
LENHHWRSAVGLLRESGLFSHLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHR    281 - 350
HLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYL    351 - 420
VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENRLS            421 - 482
//

Text Mined References (28)

PMID Year Title
25128584 2014 PDE7A1 hydrolyzes cCMP.
23661015 2013 Inhibition of endogenous phosphodiesterase 7 promotes oligodendrocyte precursor differentiation and survival.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19350606 2009 Synthesis, structural analysis, and biological evaluation of thioxoquinazoline derivatives as phosphodiesterase 7 inhibitors.
18420479 2008 Effects of phosphodiesterase 7 inhibition by RNA interference on the gene expression and differentiation of human mesenchymal stem cell-derived osteoblasts.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15994308 2005 Multiple elements jointly determine inhibitor selectivity of cyclic nucleotide phosphodiesterases 4 and 7.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15470020 2004 A-kinase anchoring proteins interact with phosphodiesterases in T lymphocyte cell lines.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12737631 2003 Functional characterization of the human phosphodiesterase 7A1 promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388353 2003 Ubiquitous expression of phosphodiesterase 7A in human proinflammatory and immune cells.
11812656 2002 PDE7A is expressed in human B-lymphocytes and is up-regulated by elevation of intracellular cAMP.
11371644 2001 T cell activation up-regulates cyclic nucleotide phosphodiesterases 8A1 and 7A3.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
10913353 2000 Phosphodiesterases 4D and 7A splice variants in the response of HUVEC cells to TNF-alpha(1).
10393044 1999 Multiple cyclic nucleotide phosphodiesterases in human trabecular meshwork cells.
9521885 1998 Assignment of the mouse Pde7A gene to the proximal region of chromosome 3 and of the human PDE7A gene to chromosome 8q13.
9195912 1997 Alternative splicing of the high affinity cAMP-specific phosphodiesterase (PDE7A) mRNA in human skeletal muscle and heart.
8943082 1996 Identification and tissue-specific expression of PDE7 phosphodiesterase splice variants.
8389765 1993 Isolation and characterization of a previously undetected human cAMP phosphodiesterase by complementation of cAMP phosphodiesterase-deficient Saccharomyces cerevisiae.
8009369 1994 Chromosome localizations of genes for five cAMP-specific phosphodiesterases in man and mouse.