Property Summary

NCBI Gene PubMed Count 24
PubMed Score 20.08
PubTator Score 8.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.900 8.0e-05
medulloblastoma, large-cell 1.300 2.7e-02

Protein-protein Interaction (11)

Gene RIF (5)

PMID Text
20979602 Collectively, we report previously unrecognized PDE6 expression in human lungs, significant alterations of the PDE6D and PDE6G/H subunits in IPF lungs.
20655036 These findings demonstrate the positive role of the gamma subunit in maintaining phosphodiesterase activity and confirm the contribution of PDE6G to the etiology of retinitis pigmentosa in humans.
20397626 The C-terminus of PED gamma occludes the active site of PDE6, thereby preventing hydrolysis of cGMP.
19798052 Crystal structures of a chimaeric PDE5/PDE6 catalytic domain (PDE5/6cd) complexed with sildenafil or 3-isobutyl-1-methylxanthine and the Pgamma-inhibitory peptide Pgamma(70-87) have been determined at 2.9 and 3.0 A, respectively.
12624098 PDEG functions to link c-Src and G-protein-coupled receptor kinase 2 in a signaling unit that regulates p42/p44 mitogen-activated protein kinase by epidermal growth factor

AA Sequence

MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPW      1 - 70
EAFNHLELHELAQYGII                                                          71 - 87
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20979602 2010 Phosphodiesterase 6 subunits are expressed and altered in idiopathic pulmonary fibrosis.
20655036 2010 Autosomal-recessive early-onset retinitis pigmentosa caused by a mutation in PDE6G, the gene encoding the gamma subunit of rod cGMP phosphodiesterase.
20397626 2010 Determinants for phosphodiesterase 6 inhibition by its gamma-subunit.
19798052 2009 Structural basis of phosphodiesterase 6 inhibition by the C-terminal region of the gamma-subunit.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16357825 2005 The regulatory subunit of PDE6 interacts with PACSIN in photoreceptors.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14502124 2003 A proline-rich domain in the gamma subunit of phosphodiesterase 6 mediates interaction with SH3-containing proteins.
12624098 2003 The inhibitory gamma subunit of the type 6 retinal cGMP phosphodiesterase functions to link c-Src and G-protein-coupled receptor kinase 2 in a signaling unit that regulates p42/p44 mitogen-activated protein kinase by epidermal growth factor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
11502744 2001 The inhibitory gamma subunit of the type 6 retinal cyclic guanosine monophosphate phosphodiesterase is a novel intermediate regulating p42/p44 mitogen-activated protein kinase signaling in human embryonic kidney 293 cells.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8557689 1996 Isolation and characterization of cDNAs corresponding to two human calcium, calmodulin-regulated, 3',5'-cyclic nucleotide phosphodiesterases.
8406511 1993 Physical and genetic localization of the gamma subunit of the cyclic GMP phosphodiesterase on the long arm of chromosome 17 (17q25).
8125719 1994 Evaluation of the gene encoding the gamma subunit of rod phosphodiesterase in retinitis pigmentosa.
7828894 1994 Cloning and characterization of the gene encoding the cGMP-phosphodiesterase gamma-subunit of human rod photoreceptor cells.
2161380 1990 Isolation and characterization of cDNA encoding the gamma-subunit of cGMP phosphodiesterase in human retina.
1965799 1990 [The organization of the gamma-subunit gene of human photoreceptor cyclic GMP phosphodiesterase].
1683837 1991 Genetic analysis of patients with retinitis pigmentosa using a cloned cDNA probe for the human gamma subunit of cyclic GMP phosphodiesterase.