Property Summary

NCBI Gene PubMed Count 28
PubMed Score 29.88
PubTator Score 9.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 2.700 2.9e-02
non primary Sjogren syndrome sicca 1.200 1.4e-02
ovarian cancer 1.100 1.2e-03

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (4)

PMID Text
24166846 Study identifies PDE6D as a novel Joubert syndrome gene and provides the first evidence of prenyl-binding-dependent trafficking in ciliopathies.
23559067 RPGR is acting as a scaffold protein recruiting cargo-loaded PDE6D and Arl3 to release lipidated cargo into cilia.
23150559 findings indicate that ARL13B, INPP5E, PDE6D, and CEP164 form a distinct functional network that is involved in JBTS and NPHP but independent of the ones previously defined by NPHP and MKS proteins
22179043 Data show that PDEdelta activity augments K/Hras signalling by enriching Ras at the plasma membrane.

AA Sequence

MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ      1 - 70
MEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLV     71 - 140
STSRVRLFYV                                                                141 - 150
//

Text Mined References (31)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25416956 2014 A proteome-scale map of the human interactome network.
24401286 2014 Prenylation defects in inherited retinal diseases.
24166846 2014 A homozygous PDE6D mutation in Joubert syndrome impairs targeting of farnesylated INPP5E protein to the primary cilium.
23698361 2013 Small molecule inhibition of the KRAS-PDE? interaction impairs oncogenic KRAS signalling.
23568457 2013 Genetic variants associated with disordered eating.
23559067 2013 The interplay between RPGR, PDE? and Arl2/3 regulate the ciliary targeting of farnesylated cargo.
23301619 2013 Identification of PDE6D as a molecular target of anecortave acetate via a methotrexate-anchored yeast three-hybrid screen.
23150559 2012 ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting.
22179043 2011 The GDI-like solubilizing factor PDE? sustains the spatial organization and signalling of Ras family proteins.
22002721 2011 Arl2-GTP and Arl3-GTP regulate a GDI-like transport system for farnesylated cargo.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
18588884 2008 Specificity of Arl2/Arl3 signaling is mediated by a ternary Arl3-effector-GAP complex.
18391951 2008 Many sequence variants affecting diversity of adult human height.
16527812 2006 Internalization and recycling of the human prostacyclin receptor is modulated through its isoprenylation-dependent interaction with the delta subunit of cGMP phosphodiesterase 6.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11980706 2002 The complex of Arl2-GTP and PDE delta: from structure to function.
11786539 2002 The delta subunit of retinal rod cGMP phosphodiesterase regulates the membrane association of Ras and Rap GTPases.
10518933 1999 The delta subunit of rod specific cyclic GMP phosphodiesterase, PDE delta, interacts with the Arf-like protein Arl3 in a GTP specific manner.
10373499 1999 cGMP binding to noncatalytic sites on mammalian rod photoreceptor phosphodiesterase is regulated by binding of its gamma and delta subunits.
9990021 1999 The retinitis pigmentosa GTPase regulator, RPGR, interacts with the delta subunit of rod cyclic GMP phosphodiesterase.
9781033 Cloning and gene structure of the rod cGMP phosphodiesterase delta subunit gene (PDED) in man and mouse.
9712853 1998 The rod cGMP phosphodiesterase delta subunit dissociates the small GTPase Rab13 from membranes.
9570951 1998 Characterization of human and mouse rod cGMP phosphodiesterase delta subunit (PDE6D) and chromosomal localization of the human gene.
9533031 1997 cDNA sequence, genomic organization and mapping of PDE6D, the human gene encoding the delta subunit of the cGMP phosphodiesterase of retinal rod cells to chromosome 2q36.
8798640 1996 Solubilization of membrane-bound rod phosphodiesterase by the rod phosphodiesterase recombinant delta subunit.