Property Summary

NCBI Gene PubMed Count 28
PubMed Score 20.27
PubTator Score 93.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Retinitis Pigmentosa 223 5.316 2.7
RETINITIS PIGMENTOSA 43 3 0.0 0.0
Disease Target Count P-value
psoriasis 6514 1.3e-45
lung adenocarcinoma 2627 8.0e-13
active ulcerative colitis 736 5.1e-03
active Crohn's disease 882 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Macular retinal edema 12 3.767 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease -2.120 1.6e-02
active ulcerative colitis -2.428 5.1e-03
lung adenocarcinoma -1.300 8.0e-13
psoriasis -3.100 1.3e-45

Gene RIF (13)

AA Sequence

MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQE      1 - 70
NLQTEKCIFNVMKKLCFLLQADRMSLFMYRTRNGIAELATRLFNVHKDAVLEDCLVMPDQEIVFPLDMGI     71 - 140
VGHVAHSKKIANVPNTEEDEHFCDFVDILTEYKTKNILASPIMNGKDVVAIIMAVNKVDGSHFTKRDEEI    141 - 210
LLKYLNFANLIMKVYHLSYLHNCETRRGQILLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLL    211 - 280
DMTKQKEFFDVWPVLMGEVPPYSGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPAYV    281 - 350
AQNGLICNIMNAPAEDFFAFQKEPLDESGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM    351 - 420
ESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPWECEEEELAEI    421 - 490
LQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQEALVRFMYSLSKGYRKITYHN    491 - 560
WRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHDIDHRGTNNLYQMKSQNPLAKLHGSSILERH    561 - 630
HLEFGKTLLRDESLNIFQNLNRRQHEHAIHMMDIAIIATDLALYFKKRTMFQKIVDQSKTYESEQEWTQY    631 - 700
MMLEQTRKEIVMAMMMTACDLSAITKPWEVQSQVALLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELP    701 - 770
KLQVGFIDFVCTFVYKEFSRFHEEITPMLDGITNNRKEWKALADEYDAKMKVQEEKKQKQQSAKSAAAGN    771 - 840
QPGGNPSPGGATTSKSCCIQ                                                      841 - 860
//

Text Mined References (28)

PMID Year Title