Property Summary

Ligand Count 433
NCBI Gene PubMed Count 188
PubMed Score 166.50
PubTator Score 230.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Brachydactyly 156
Pseudohypoparathyroidism 18
ACRODYSOSTOSIS 2 WITH OR WITHOUT HORMONE RESISTANCE 1
Abnormality of female external genitalia 8
Abnormality of immune system physiology 16
Abnormally-shaped vertebrae 31
Absent/hypoplastic paranasal sinuses 5
Acquired scoliosis 281
Advanced bone age 35
Anteverted nostril 191
Autistic Disorder 364
Blonde hair 7
Brachycephaly 88
Broad cranium shape 88
Broad flat nasal bridge 236
Cerebrovascular accident 63
Class III malocclusion 78
Cognitive delay 608
Concave bridge of nose 195
Cone-shaped epiphyses 24
Congenital craniofacial dysostosis 2
Congenital deafness 185
Congenital hypoplasia of radius 23
Congenital hypothyroidism 26
Cryptorchidism 296
Curvature of spine 282
Deafness 198
Decreased projection of maxilla 66
Decreased projection of midface 105
Deficiency of upper jaw bones 66
Delayed speech and language development 112
Depressed nasal bridge 195
Depressed nasal ridge 51
Depressed nasal root/bridge 195
Depressive disorder 409
Dull intelligence 645
Elevated calcitonin 3
Fair hair 7
Fetal Growth Retardation 189
Global developmental delay 608
Hearing Loss, Partial 185
Hyperactive behavior 91
Hyperphosphatemia (disorder) 17
Hypertrophy of lower jaw 78
Hypocalcemia 32
Hypogonadism 173
Hypoplasia of the maxilla 66
Hypoplasia of the nasal bone 2
Hypoplastic toes 29
Hypoplastic vertebral bodies 7
Hypotrophic malar bone 129
Hypotrophic maxilla 66
Hypotrophic midface 105
Increased serum parathyroid hormone 14
Increased size of mandible 78
Infant, Small for Gestational Age 176
Intellectual disability 1016
Intracranial hypertension 32
Intrauterine retardation 176
Isolated somatotropin deficiency 30
Language Delay 112
Late tooth eruption 61
Low intelligence 645
Malar flattening 129
Mandibular hyperplasia 78
Maxillary retrognathia 66
Mental Depression 333
Mental Retardation 645
Mental and motor retardation 608
Mental deficiency 645
Micromelia 58
Midface retrusion 105
Nail Diseases 24
Nail abnormality 22
Narrow interpedicular space 4
Nasal bridge wide 236
Neuropathy 261
Obesity 678
Open mouth 45
Orbital separation excessive 244
Penile hypospadias 106
Peripheral Neuropathy 134
Poor school performance 645
Prenatal onset 139
Radial ray hypoplasia 23
Red hair 6
Relative short stature 13
Retrusion of upper jaw bones 66
Round face 45
Round, full face 45
SERUM PHOSPHATE ELEVATED 14
Schizophrenia 1160
Short metacarpal 43
Short metatarsal 21
Short nose 132
Short phalanx of finger 32
Short stature 531
Short stature, mild 13
Short ulnae 24
Small midface 105
Small nose 132
Specific learning disability 47
Speech Delay 112
Speech impairment 112
Spinal canal stenosis 12
Stippled epiphyses 28
Thrombosis of cerebral veins 6
ULNAR HYPOPLASIA 24
Wide skull shape 88
blue iris (physical finding) 17
diabetes mellitus 1728
hearing impairment 199
mandibular excess (physical finding) 78
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma 1.048 3.7e-02
adult high grade glioma -1.800 2.1e-05
astrocytic glioma -1.300 6.9e-03
Astrocytoma, Pilocytic -1.100 3.6e-05
atypical teratoid / rhabdoid tumor 1.200 3.6e-02
colon cancer -1.400 4.4e-02
Crohn's disease -1.066 3.2e-03
glioblastoma -1.300 7.2e-07
hepatocellular carcinoma -1.300 1.7e-03
interstitial lung disease -1.300 4.2e-02
intraductal papillary-mucinous adenoma (... 1.500 3.1e-03
intraductal papillary-mucinous carcinoma... 1.300 8.6e-04
intraductal papillary-mucinous neoplasm ... 1.300 3.4e-04
lung cancer 2.100 1.3e-04
medulloblastoma, large-cell -1.500 3.3e-02
non primary Sjogren syndrome sicca -1.200 2.7e-02
non-small cell lung cancer -1.028 1.0e-11
pancreatic cancer -1.100 6.6e-03
pancreatic carcinoma -1.100 6.6e-03
primitive neuroectodermal tumor -1.500 7.6e-03
psoriasis -1.100 1.3e-02
tuberculosis -1.700 2.1e-05
ulcerative colitis -1.311 6.0e-04

Protein-protein Interaction (1)

Gene RIF (158)

AA Sequence

MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPPPPPSPQPQPQ      1 - 70
CPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRAMDRTSYAVETGHRPGLKKSR     71 - 140
MSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQANFVHSQRRESFLYRSDSDYDLSPKSMSRNS    141 - 210
SIASDIHGDDLIVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASET    211 - 280
LEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPT    281 - 350
QKEKEKKKRPMSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL    351 - 420
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDL    421 - 490
EILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQ    491 - 560
SLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQL    561 - 630
YRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDT    631 - 700
LEDNREWYQSTIPQSPSPAPDDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCT    701 - 770
QDSESTEIPLDEQVEEEAVGEEEESQPEACVIDDRSPDT                                   771 - 809
//

Text Mined References (201)

PMID Year Title