Property Summary

NCBI Gene PubMed Count 176
PubMed Score 166.99
PubTator Score 230.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (23)

Disease log2 FC p
hepatocellular carcinoma -1.300 1.7e-03
pancreatic cancer -1.100 6.6e-03
interstitial lung disease -1.300 4.2e-02
astrocytic glioma -1.400 5.0e-03
psoriasis -1.100 1.3e-02
glioblastoma -1.800 3.5e-05
atypical teratoid / rhabdoid tumor 1.200 3.6e-02
medulloblastoma, large-cell -1.700 5.5e-03
primitive neuroectodermal tumor -1.500 7.6e-03
Crohn's disease -1.066 3.2e-03
ulcerative colitis -1.311 6.0e-04
adrenocortical carcinoma 1.048 3.7e-02
tuberculosis -1.700 2.1e-05
non-small cell lung cancer -1.368 1.7e-16
intraductal papillary-mucinous adenoma (... 2.900 8.9e-05
intraductal papillary-mucinous carcinoma... 1.900 3.4e-03
intraductal papillary-mucinous neoplasm ... 1.700 7.0e-04
colon cancer -2.200 1.1e-03
lung cancer 2.100 1.3e-04
adult high grade glioma -1.800 2.1e-05
pilocytic astrocytoma -1.100 2.4e-05
non primary Sjogren syndrome sicca -1.200 2.7e-02
pancreatic carcinoma -1.100 6.6e-03

Gene RIF (148)

PMID Text
26782593 While prior studies have found an association between PDE4D and IL6R polymorphisms and ischemic stroke, the results of this study suggest that this association may be different in a hypertensive population.
26671126 This review show PDE4D mutation is a risk factor for atrial fibrillation and stroke.
26575822 Data highlight an increase in PDE4D7 expression during initial tumorigenesis and further support the findings that PDE4D7 levels fall profoundly in castration resistant prostate cancer, suggesting it as a potential biomarker and therapeutic target.
26371509 PDE4D interacts directly with Neuropilins, positive regulators of Hedgehog signal transduction pathway.
26345966 The increase in the C allele frequency at 87 single nucleotide polymorphism sites in PDE4D may increase ischemic stroke risk.
26211680 In this article, we review the role of the cAMP signal transduction pathway in memory formation with a particular focus on the recent progress in PDE4D research
26181301 Aberrant DNA methylation of PDE4D promoter alters airway smooth muscle cell phenotypes.
25775568 structural analysis of the autoinhibited conformation of PDE4
25680530 PKA phosphorylation of the PDE4D7 N-terminus appears to occur constitutively and inhibits PDE4 activity to allow cAMP signalling under basal conditions.
25546709 Critical residues stabilising PDE4D5 dimerization were defined within the regulatory UCR1 region found in long, but not short, PDE4 isoforms, namely the Arg(173), Asn(174) and Asn(175) (DD1) cluster.
25149359 These studies suggest the pharmacologic inhibition of PDE4D using small-molecule inhibitors is an effective option for prostate cancer therapy.
25122068 The knockdown of PDE4D gene expression inhibited proliferation of STK11-mutated lung cancer lines. Furthermore, challenge with a panel of PDE4-specific inhibitors was shown to selectively reduce the growth of STK11-mutated lung cancer lines.
25101859 PDE3A1 and PDE4D3 are integrated into complexes that contain the 5-HT4(b) receptor and may thereby regulate 5-HT4(b) receptor-mediated signaling.
25064455 specific inhibitory PDE4D mutations can lead to the molecular pathology of acrodysostosis without hormone resistance but that the pathological phenotype may well be dependent on an over-compensatory induction of other PDE4 isoforms
24926854 This result supports that PDE4D polymorphisms might be involved in the susceptibility to COPD especially in non-emphysematous individuals and that they could also affect the responsiveness of the PDE4 inhibitor treatment.
24732776 Cyclic AMP phosphodiesterase inhibitors AV411 and AV1013 inhibit HIV-1 replication and block HIV-1 Tat-induced neurotoxicity in human microglia, suggesting that cyclic AMP phosphodiesterase is involved in the Tat-mediated neurotoxicity
24485247 No association was found between single-nucleotide polymorphisms of ALOX5AP or PDE4D and the risk of overall ischemic stroke in a southeastern Chinese population.
24365247 This study found an association between SNP83 and ischemic stroke in the overall population and in the Asian and Chinese populations, but not among Caucasians.
24203977 haploinsufficiency of PDE4D results in a novel intellectual disability syndrome, the 5q12.1-haploinsufficiency syndrome, with several opposing features compared with acrodysostosis that is caused by dominant negative mutations.
24142618 Multiple factors contribute to the pathogenesis of nasal polyps including genetic predisposition. The PDE4D family has gained interest in the complex pathogenesis of nasal polyposis. This is likely linked to the mucosal inflammatory response.
23863764 Patients with the C/C genotype of SNP 83 exhibited significantly more cognitive dysfunction at 1 day (29.7%) than the C/T (15.8%, P = .008) and T/T (12.7%, P = .01) genotypes.
23852788 PDE4D gene variants 83 and 87 did not show any significant association with coronaary heart disease, but may indirectly associate with risk agents of CHD>
23806656 Comparative analysis of the binding responses of mutations to mAKAP could provide important information about how these mutations modulate PKA and PDE4D3 signaling.
23799094 results suggest that SNP 83 in PDE4D gene is significantly associated with susceptibility to ischemic stroke in Chinese population
23786009 An increased frequency of phosphodiesterase 4D TT genotype is associated with risk of myocardial infarction in men over 60 years old.
23778321 research analyzed association of rs702553 with baseline mean arterial blood pressure in a subset of the African American Study of Kidney Disease and Hypertension Cohort; compared with participants with AA/AT genotypes, those with a TT genotype at rs702553 had significantly lower baseline MAP among study participants on a diuretic
23536305 although targeted by genomic homozygous microdeletions, PDE4D functions as a tumor-promoting factor and represents a unique targetable enzyme of cancer cells
23466835 results suggest that the rs918592 and rs2910829 polymorphisms and haplotypes of PDE4D gene are significantly associated with ischemic stroke in Chinese young population.
23266473 PDE4D5-beta-arrestin2 complex allowed the recruitment of Epac1 to beta2AR and induced a switch from beta2AR non-hypertrophic signaling to a beta1AR-like pro-hypertrophic signaling cascade.
23241943 Single nucleotide polymorphisms in PDE4D is associated with response to antipsychotic agents in schizophrenia.
23135027 PDE4D has been identified as a predisposition gene for ischemic stroke in Southern as well as the Northern population of India.
23120769 Genotypes AA and AG were associated with the higher risk of stroke in the Moscow population (OR 1,6). No association between SNP87 and stroke was found.
23076369 Data indicate that single-nucleotide polymorphisms (SNPs) in 5-lipoxygenase activating protein (ALOX5AP), phosphodiesterase 4D (PDE4D), and interleukin-1alpha (IL-1alpha) were associated with an increased risk of atherothrombotic stroke (ATS) in Chinese.
23043190 Phenotypic differences, including the presence of resistance to GPCR-cAMP signaling hormones in PRKAR1A but not PDE4D patients, indicate phenotype-genotype correlations and highlight the specific contributions of PRKAR1A and PDE4D in cAMP signaling.
23033274 Data indicate that missense mutations were identified in all acrodysostosis patients.
22908311 Protein kinase A-PDE4D3-A kinase anchor protein (AKAP)9 complex generates spatial compartmentalization of cyclic adenosine monophosphate (cAMP) signaling at the centrosome.
22882844 The present study demonstrated a strong association of phosphodiesterase 4D rs918592 with ischemic stroke. Haplotype A-T increased the risk of IS while haplotype G-T had a protective effect in Henan Han population.
22771915 SNPs in the PDE4D gene plays a key part in the pathogenesis of ischemic stroke in the South Indian population from Andhra Pradesh.
22464252 Three different missense mutations in PDE4D were heterozygous in three of five acrodysostosis cases. Two of the mutations were demonstrated to have occurred de novo.
22464250 Exome analysis detected PDE4D mutations (c.673C>A [p.Pro225Thr] and c.677T>C [p.Phe226Ser]) in two acrodysostosis cases. Screening of PDE4D identified mutations (c.568T>G [p.Ser190Ala] and c.1759A>C [p.Thr587Pro]) in two other cases.
22274584 No association is found between ischaemic stroke and rs12188950 in the PDE4D gene.
22045424 The frequency of CC genotype of PDE4D83 was significantly higher in the patients with ischemic stroke compared to controls
21989204 Our findings demonstrated an association between cardioembolic stroke and phosphodiesterase 4D single nucleotide polymorphisms
21903937 Phosphodiesterase 4D regulates baseline sarcoplasmic reticulum Ca2+ release and cardiac contractility, independently of L-type Ca2+ current.
21876611 Results identify new genetic variants of phosphodiesterase type 4D implicated in modulation of asthma treatment, one of them (rs1544791) previously associated with asthma phenotype.
21786629 No significant association of the PDE4D with ischemic stroke was observed with SNP41 and 87.
21677445 A meta-analysis has shown a significant positive association between phosphodiesterase 4D (PDE4D) gene variants and stroke.
21611147 Decreased beta-agonist induced cAMP in airway smooth muscle from asthmatics results from enhanced degradation due to increased PDE4D expression.
20952536 Studies identified phosphodiesterase 4D3 as a direct target of the MSH/cAMP/MITF pathway.
20837708 results suggest a novel regulatory mechanism for mTORC1 in which the cAMP-determined dynamic interaction between Rheb and PDE4D provides a key, unique regulatory event, and propose a new role for PDE4 as a molecular transducer for cAMP signaling.
20819076 Results reveal novel signalling cross-talk, whereby RACK1 mediates PKC-dependent activation of PDE4D5 in the particulate fraction of HEK-293 cells in response to elevations in intracellular cAMP.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20734779 Phosphodiesterase 4D (PDE4D) gene polymorphism in patients with acute stroke from Moscow
20734779 Observational study of gene-disease association. (HuGE Navigator)
20732872 PDE4D tethers EPAC1 in a vascular endothelial cadherin (VE-Cad)-based signaling complex and controls cAMP-mediated vascular permeability
20634892 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20540798 Observational study of gene-disease association. (HuGE Navigator)
20503266 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20357438 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20182758 Meta-analysis of gene-disease association. (HuGE Navigator)
20161734 Meta-analysis of gene-disease association. (HuGE Navigator)
20106966 cAMP-stimulated protein phosphatase 2A activity associated with muscle A kinase-anchoring protein (mAKAP) signaling complexes inhibits the phosphorylation and activity of the cAMP-specific phosphodiesterase PDE4D3
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19786079 single-nucleotide polymorphisms of the PDE4D (83T/C) and IL-1A (-889C/T) (but not IL-1B)were associated with increased risk for the development of ischemic stroke in Northern Han Chinese
19608201 our results suggest that single nucleotide polymorphisms 83 of PDE4D gene is significantly associated with ischemic stroke in the South Indian population from Andhra Pradesh
19608201 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19426955 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19426955 The phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila) gene (PDE4D) is a regulator of airway smooth-muscle contractility, and PDE4 inhibitors have been developed as medications for asthma.
19424605 The TAAAright curved arrow del polymorphism of PDE4D were associated with chronic kidney disease in low-risk individuals.
19417766 we found no evidence of association between PDE4D and ALOX5AP genes and the risk of IS in a genetically homogenous population from Sardinia.
19417766 Observational study of gene-disease association. (HuGE Navigator)
19399275 A Cyclic Nucleotide Phosphodiesterases, Type 4 single nucleotide polymorphism as a candidate marker for susceptibility to ischemic stroke.
19399275 Observational study of gene-disease association. (HuGE Navigator)
19372219 a beta-arrestin-scaffolded pool of the E3-ubiquitin ligase, Mdm2, mediates PDE4D5 ubiquitination
19282863 Observational study of gene-disease association. (HuGE Navigator)
19251251 Observational study of gene-disease association. (HuGE Navigator)
19246712 variations in PDE4D are not associated with ischemic stroke risk in the Japanese population
19246712 Observational study of gene-disease association. (HuGE Navigator)
19196240 findings show that polymorphisms in the PDE4D gene are associated with an increased risk of ischaemic stroke in the Chinese Han population.
19196240 Observational study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
18977990 Observational study of gene-disease association. (HuGE Navigator)
18711446 Some polymorphisms of PDE4D show associations with personality traits related to neuroticism.
18705898 There may be racial differences in the prevalence of mutations but still many questions remain unsolved regarding the role of PDE4D in stroke development. [REVIEW]
18694398 Observational study of gene-disease association. (HuGE Navigator)
18514160 Observational study of gene-disease association. (HuGE Navigator)
18420948 No genetic variant examined in PDE4D showed a robust and reproducible association to ischemic stroke [meta-analysis]
18420948 Meta-analysis of gene-disease association. (HuGE Navigator)
18398440 Meta-analysis of ischemic stroke patients and controls indicates that T alleles of preselected single nucleotide polymorphisms SNP45 and SNP39 in the PDE4D genome region are ischemic stroke risk reducers, especially among subjects with hypertension.
18398440 Observational study and meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
18158110 Observational study of gene-disease association. (HuGE Navigator)
18157711 Observational study of gene-disease association. (HuGE Navigator)
17956250 beta-arrestin-sequestered PDE4D5 shapes the spatial cAMP gradient around the membrane-bound beta(2)-AR, regulating its phosphorylation by protein kinase A
17900862 Examined interactions between phosphodiesterase 4D5 (PDE4D5) and beta-arrestin and RACK1.
17884339 Cells can contain several non-overlapping PKA- and EPAC-based signaling complexes that allow PDE4D/PDE3B coordination of cell adhesion.
17673687 that PDE4D5, despite being a minor component of the tissue PDE pool, is the key physiological regulator of beta(2)AR-induced cAMP turnover within human airway smooth muscle.
17667963 Genome-wide association study of gene-disease association. (HuGE Navigator)
17655870 Observational study of gene-disease association. (HuGE Navigator)
17655870 The PDE4D SNPs, showed a non-significant risk in the ICVD group which increased for the Large Artery Atherosclerosis subtype.
17594329 Observational study of gene-disease association. (HuGE Navigator)
17594329 Significantly different distributions were seen with respect to the AC008818-1 alleles. Allele 148 associates with an increased risk of stroke incidence, & allele 144 with a protective effect. PDE4D may be involved in stroke etiology and pathogenesis.
17088426 Compartmentalized PDE4B acts as a sink to drain cAMP from discrete locations, resulting in multiple domains with different cAMP concentrations.
17065074 cAMP-PDE activity is upregulated in malignant cells of human salivary glands
17016624 Observational study of gene-disease association. (HuGE Navigator)
17016624 SNP13 and haplotypes, SNP7 G/A and IL13 +2044 G/A, may be useful for predicting chronic obstructive pulmonary disease susceptibility.
16973330 We identify a novel process through which reactive oxygen species activate long PDE4 isoforms so as to reduce cAMP levels and thereby promote inflammatory responses.
16914755 results and the pooled analyses from all the studies indicate a strong association between PDE4D and ischaemic stroke; this strengthens the evidence that PDE4D plays a key part in the pathogenesis of ischaemic stroke
16835261 Observational study of gene-disease association. (HuGE Navigator)
16825591 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16825591 Modest associations between several PDE4D gene polymorphisms and risk of incident ischemic stroke in men without baseline hypertension.
16689683 RACK1 and beta-arrestin compete to sequester distinct 'pools' of PDE4D5.
16675738 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16675738 Four of the SNPs and the microsatellite AC008818-1 showed association with stroke after stratification by hypertension.
16642035 Results suggest that gravin maintains a signaling complex that includes protein kinase A and phosphodiesterase 4D.
16543535 Observational study of gene-disease association. (HuGE Navigator)
16373644 Observational study of gene-disease association. (HuGE Navigator)
16373644 PDE4D may have a role in ischemic stroke and cardioembolic stroke
16322495 Observational study of gene-disease association. (HuGE Navigator)
16322495 STRK1 may have a role in development of cerebral infarction
16166573 Observational study of gene-disease association. (HuGE Navigator)
16166573 the PDE4D polymorphism may have a role in development of ischemic stroke in Pakistan
16162858 There was familial aggregation of ischemic stroke and a difference in degree of familial clustering between stroke subtypes. The authors also found that the PDE4D gene is significantly associated with small-vessel infarction in inbred individuals.
16130105 The data of this study suggest that common variants in PDE4D may contribute to the genetic risk for ischemic stroke in multiple populations.
16030021 RNA interference identifies PDE4d as the interacting cAMP phosphodiesterase interacting with beta-arrestin to control the protein kinase A-mediated switching of the beta2-adrenergic receptor to activation of ERK.
16020760 Observational study of gene-disease association. (HuGE Navigator)
16020760 genetic analysis of linkage of stroke susceptibility to the PDE4D gene region on chromosome 5q
15861005 Studies that employ genome-wide linkage scans with hundreds of small nuclear families have identified new susceptibility genes for coronary artery disease and myocardiaI infarction, including PDE4D (encoding phosphodiesterase 4D) for ischemic stroke.
15802632 Observational study of gene-disease association. (HuGE Navigator)
15802632 Lack of association of the PDE4D gene as a major risk factor for ischemic stroke, or early carotid atherosclerosis.
15752431 Observational study of gene-disease association. (HuGE Navigator)
15731479 Observational study of gene-disease association. (HuGE Navigator)
15731479 Variants in the ALOX5AP gene but not the PDE4D gene are associated with risk for stroke in individuals from central Europe
15611099 PDE4D forms a cAMP diffusion barrier at the apical membrane of the airway epithelium
15131123 oligomerization state determines regulatory properties and inhibitor sensitivity of PDE4
14668322 Crystal structures of phosphodiesterases 4 and 5 in complex with inhibitor 3-isobutyl-1-methylxanthine
14609333 In the crystal structure of PDE4D2 catalytic domain in complex with AMP, two divalent metal ions simultaneously interact with the phosphate group of AMP, implying a binuclear catalysis.
14517540 fine mapping of locus and testing for association with stroke
12834813 Reported here the cloning and characterization of two novel PDE4D isoforms, PDE4D6 and PDE4D7.
12552097 beta-Arrestin-mediated PDE4 cAMP phosphodiesterase recruitment regulates beta-adrenoceptor switching from Gs to Gi and thereby activation of ERK
12399592 Targeting of cyclic AMP degradation to beta 2-adrenergic receptors by beta-arrestins show a role for PDE4D
12121997 PDE4D5 is upregulated in tracheal smooth muscle cells because of a CRE-containing, isoform-specific promoter
11839681 Inhibition of PDE3B augments PDE4 inhibitor-induced apoptosis in a subset of patients with chronic lymphocytic leukemia
11156964 Cyclic AMP phosphodiesterase inhibitors AV411 and AV1013 inhibit HIV-1 replication and block HIV-1 Tat-induced neurotoxicity in human microglia, suggesting that cyclic AMP phosphodiesterase is involved in the Tat-mediated neurotoxicity

AA Sequence

MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPPPPPSPQPQPQ      1 - 70
CPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRAMDRTSYAVETGHRPGLKKSR     71 - 140
MSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQANFVHSQRRESFLYRSDSDYDLSPKSMSRNS    141 - 210
SIASDIHGDDLIVTPFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASET    211 - 280
LEELDWCLDQLETLQTRHSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPT    281 - 350
QKEKEKKKRPMSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL    351 - 420
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDL    421 - 490
EILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQ    491 - 560
SLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQL    561 - 630
YRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDT    631 - 700
LEDNREWYQSTIPQSPSPAPDDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCT    701 - 770
QDSESTEIPLDEQVEEEAVGEEEESQPEACVIDDRSPDT                                   771 - 809
//

Text Mined References (189)

PMID Year Title
26782593 2015 Association of phosphodiesterase 4D gene and interleukin-6 receptor gene polymorphisms with ischemic stroke in a Chinese hypertensive population.
26671126 2015 Phosphodiesterase4D (PDE4D)--A risk factor for atrial fibrillation and stroke?
26575822 2015 Human phosphodiesterase 4D7 (PDE4D7) expression is increased in TMPRSS2-ERG-positive primary prostate cancer and independently adds to a reduced risk of post-surgical disease progression.
26371509 2015 Phosphodiesterase 4D acts downstream of Neuropilin to control Hedgehog signal transduction and the growth of medulloblastoma.
26345966 2015  Investigation of single nucleotide polymorphisms in phosphodiesterase 4D gene in Mongol and Han patients with ischemic stroke in Inner Mongolia.
26211680 2015 Phosphodiesterase 4D: an enzyme to remember.
26181301 2016 Aberrant DNA Methylation of Phosphodiesterase [corrected] 4D Alters Airway Smooth Muscle Cell Phenotypes.
25775568 2015 Engineered stabilization and structural analysis of the autoinhibited conformation of PDE4.
25680530 2015 The activity of cAMP-phosphodiesterase 4D7 (PDE4D7) is regulated by protein kinase A-dependent phosphorylation within its unique N-terminus.
25546709 2015 Dimerization of cAMP phosphodiesterase-4 (PDE4) in living cells requires interfaces located in both the UCR1 and catalytic unit domains.
25416956 2014 A proteome-scale map of the human interactome network.
25149359 2015 Phosphodiesterase 4D inhibitors limit prostate cancer growth potential.
25129146 2014 Joint analysis of three genome-wide association studies of esophageal squamous cell carcinoma in Chinese populations.
25122068 2014 Integrated analysis of transcriptomes of cancer cell lines and patient samples reveals STK11/LKB1-driven regulation of cAMP phosphodiesterase-4D.
25101859 2014 Phosphodiesterase 4 interacts with the 5-HT4(b) receptor to regulate cAMP signaling.
25064455 2014 Heterozygous mutations in cyclic AMP phosphodiesterase-4D (PDE4D) and protein kinase A (PKA) provide new insights into the molecular pathology of acrodysostosis.
24926854 2014 Polymorphisms in PDE4D are associated with a risk of COPD in non-emphysematous Koreans.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24485247 2015 Ischemic stroke risk in a southeastern Chinese population: Insights from 5-lipoxygenase activating protein and phosphodiesterase 4D single-nucleotide polymorphisms.
24365247 2014 Association between phosphodiesterase 4D polymorphism SNP83 and ischemic stroke.
24203977 2014 Different mutations in PDE4D associated with developmental disorders with mirror phenotypes.
24142618 2013 Evaluation of patients with nasal polyps about the possible association of desmosomal junctions, RORA and PDE4D gene.
23863764 2013 Phosphodiesterase 4D single-nucleotide polymorphism 83 and cognitive dysfunction in carotid endarterectomy patients.
23852788 2013 PDE4D gene polymorphisms and coronary heart disease: a case-control study in a north Indian population.
23806656 2013 Protein kinase A and phosphodiesterase-4D3 binding to coding polymorphisms of cardiac muscle anchoring protein (mAKAP).
23799094 2013 Genetic polymorphism in PDE4D gene and risk of ischemic stroke in Chinese population: a meta-analysis.
23786009 2012 [Association of rs966221 phosphodiesterase 4D gene's polymorphism with risk of myocardial infarction].
23778321 2013 Association of phosphodiesterase 4 polymorphism (rs702553) with blood pressure in the African American Study of Kidney Disease and Hypertension Genomics Study.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23536305 2013 Genomic and functional characterizations of phosphodiesterase subtype 4D in human cancers.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23466835 Genetic variants of phosphodiesterase 4D gene are associated with an enhanced risk for ischemic stroke in young Chinese population.
23266473 2013 Specific interactions between Epac1, ?-arrestin2 and PDE4D5 regulate ?-adrenergic receptor subtype differential effects on cardiac hypertrophic signaling.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23241943 2013 Genome-wide association study of patient-rated and clinician-rated global impression of severity during antipsychotic treatment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23135027 Genetics of ischemic stroke: Indian perspective.
23120769 2011 [Association of cerebral stroke with a phosphodiesterase 4D (PDE4D) gene polymorphism in the Moscow population].
23076369 2012 Association of inflammatory response gene polymorphism with atherothrombotic stroke in Northern Han Chinese.
23043190 2012 PRKAR1A and PDE4D mutations cause acrodysostosis but two distinct syndromes with or without GPCR-signaling hormone resistance.
23033274 2013 Identification of novel mutations confirms PDE4D as a major gene causing acrodysostosis.
22975349 2012 Prolyl hydroxylase domain protein 2 regulates the intracellular cyclic AMP level in cardiomyocytes through its interaction with phosphodiesterase 4D.
22908311 2012 PKA and PDE4D3 anchoring to AKAP9 provides distinct regulation of cAMP signals at the centrosome.
22882844 2012 Sex-dependent association of phosphodiesterase 4D gene polymorphisms with ischemic stroke in Henan Han population.
22771915 2012 Association of SNP41, SNP56 and a novel SNP in PDE4D gene with stroke and its subtypes.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22464252 2012 Exome sequencing identifies PDE4D mutations in acrodysostosis.
22464250 2012 Exome sequencing identifies PDE4D mutations as another cause of acrodysostosis.
22274584 2012 A large-sample assessment of possible association between ischaemic stroke and rs12188950 in the PDE4D gene.
22045424 2011 Phosphodiesterase 4 D gene polymorphism in relation to intracranial and extracranial atherosclerosis in ischemic stroke.
21989204 2011 Association of the phosphodiesterase 4D (PDE4D) gene and cardioembolic stroke in an Australian cohort.
21903937 2011 Phosphodiesterase 4D regulates baseline sarcoplasmic reticulum Ca2+ release and cardiac contractility, independently of L-type Ca2+ current.
21876611 2011 Phosphodiesterase type 4D gene polymorphism: association with the response to short-acting bronchodilators in paediatric asthma patients.
21786629 2011 [Analysis of the polymorphic variants of the PDE4D gene in patients with acute stroke in the Moldavian population].
21677445 2011 Meta-analysis of homogeneous subgroups reveals association between PDE4D gene variants and ischemic stroke.
21642993 2011 Genome-wide association study identifies three new susceptibility loci for esophageal squamous-cell carcinoma in Chinese populations.
21611147 2011 ?2-Agonist induced cAMP is decreased in asthmatic airway smooth muscle due to increased PDE4D.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20952536 2010 Control of melanocyte differentiation by a MITF-PDE4D3 homeostatic circuit.
20837708 2010 Cyclic AMP controls mTOR through regulation of the dynamic interaction between Rheb and phosphodiesterase 4D.
20819076 2010 Interaction with receptor for activated C-kinase 1 (RACK1) sensitizes the phosphodiesterase PDE4D5 towards hydrolysis of cAMP and activation by protein kinase C.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20734779 2010 [Phosphodiesterase 4D (PDE4D) gene polymorphism in patients with acute stroke from Moscow].
20732872 2010 Cyclic AMP phosphodiesterase 4D (PDE4D) Tethers EPAC1 in a vascular endothelial cadherin (VE-Cad)-based signaling complex and controls cAMP-mediated vascular permeability.
20664520 2010 Sub-picomolar relaxin signalling by a pre-assembled RXFP1, AKAP79, AC2, beta-arrestin 2, PDE4D3 complex.
20634892 2010 A genome-wide association study of neuroticism in a population-based sample.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20540798 2010 Sex-differential genetic effect of phosphodiesterase 4D (PDE4D) on carotid atherosclerosis.
20503266 2011 Allergy and glioma risk: test of association by genotype.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20357438 2010 Association of a genetic variant in the ALOX5AP with higher risk of ischemic stroke: a case-control, meta-analysis and functional study.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20196770 2010 Selective SUMO modification of cAMP-specific phosphodiesterase-4D5 (PDE4D5) regulates the functional consequences of phosphorylation by PKA and ERK.
20182758 2010 Meta-analysis of association between variation in the PDE4D gene and ischemic cerebral infarction risk in Asian populations.
20161734 2010 Causal relationship of susceptibility genes to ischemic stroke: comparison to ischemic heart disease and biochemical determinants.
20106966 2010 cAMP-stimulated protein phosphatase 2A activity associated with muscle A kinase-anchoring protein (mAKAP) signaling complexes inhibits the phosphorylation and activity of the cAMP-specific phosphodiesterase PDE4D3.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19786079 2010 Association of PDE4D and IL-1 gene polymorphism with ischemic stroke in a Han Chinese population.
19608201 2009 Phosphodiesterase 4D (PDE4D) gene variants and the risk of ischemic stroke in a South Indian population.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19426955 2009 Genome-wide association analysis identifies PDE4D as an asthma-susceptibility gene.
19424605 2009 Association of gene polymorphisms with chronic kidney disease in high- or low-risk subjects defined by conventional risk factors.
19417766 2009 Phosphodiesterase 4D and 5-lipoxygenase activating protein genes and risk of ischemic stroke in Sardinians.
19399275 2009 Phosphodiesterase 4D gene and risk of noncardiogenic ischemic stroke in a Korean population.
19372219 2009 Mdm2 directs the ubiquitination of beta-arrestin-sequestered cAMP phosphodiesterase-4D5.
19282863 2009 Association of candidate gene polymorphisms with chronic kidney disease in Japanese individuals with hypertension.
19252089 2009 Iloprost- and isoproterenol-induced increases in cAMP are regulated by different phosphodiesterases in erythrocytes of both rabbits and humans.
19251251 2009 Association between genes of Disrupted in schizophrenia 1 (DISC1) interactors and schizophrenia supports the role of the DISC1 pathway in the etiology of major mental illnesses.
19246712 2009 Lack of association between variations of PDE4D and ischemic stroke in the Japanese population.
19196240 2009 Association between the PDE4D gene and ischaemic stroke in the Chinese Han population.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
18977990 2008 Candidate genes and cerebral palsy: a population-based study.
18711446 2008 Evidence for associations between PDE4D polymorphisms and a subtype of neuroticism.
18705898 2008 Stroke genetics--focus on PDE4D gene.
18694398 2009 Phosphodiesterase 4D gene polymorphism is associated with ischaemic and haemorrhagic stroke.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18514160 2008 Phosphodiesterase 8B gene variants are associated with serum TSH levels and thyroid function.
18420948 2008 Variation in the PDE4D gene and ischemic stroke risk: a systematic review and meta-analysis on 5200 cases and 6600 controls.
18398440 2008 Ischaemic stroke in hypertensive patients is associated with variations in the PDE4D genome region.
18158110 2008 Inflammatory system gene polymorphism and the risk of stroke: a case-control study in an Indian population.
18157711 2009 Association between inflammatory gene polymorphisms and coronary artery disease in an Indian population.
18088087 2008 Phosphoproteome of resting human platelets.
17956250 2007 cAMP-specific phosphodiesterase-4D5 (PDE4D5) provides a paradigm for understanding the unique non-redundant roles that PDE4 isoforms play in shaping compartmentalized cAMP cell signalling.
17903308 2007 Genome-wide association of sleep and circadian phenotypes.
17900862 2007 1H NMR structural and functional characterisation of a cAMP-specific phosphodiesterase-4D5 (PDE4D5) N-terminal region peptide that disrupts PDE4D5 interaction with the signalling scaffold proteins, beta-arrestin and RACK1.
17884339 2007 Numerous distinct PKA-, or EPAC-based, signalling complexes allow selective phosphodiesterase 3 and phosphodiesterase 4 coordination of cell adhesion.
17727341 2007 Structures of the four subfamilies of phosphodiesterase-4 provide insight into the selectivity of their inhibitors.
17673687 2008 A major functional role for phosphodiesterase 4D5 in human airway smooth muscle cells.
17667963 2008 A whole genome association study of neuroticism using DNA pooling.
17655870 2007 PDE4D and ALOX5AP genetic variants and risk for Ischemic Cerebrovascular Disease in Sweden.
17594329 2007 Association of phosphodiesterase 4D gene G0 haplotype and ischaemic stroke in a Greek population.
17582435 2007 The molecular basis for different recognition of substrates by phosphodiesterase families 4 and 10.
17404263 2007 Differential expression and function of phosphodiesterase 4 (PDE4) subtypes in human primary CD4+ T cells: predominant role of PDE4D.
17353396 2007 Changes in PDE4D isoforms in the hippocampus of a patient with advanced Alzheimer disease.
17288540 2007 Mapping binding sites for the PDE4D5 cAMP-specific phosphodiesterase to the N- and C-domains of beta-arrestin using spot-immobilized peptide arrays.
17244609 2007 Dynamic regulation of cystic fibrosis transmembrane conductance regulator by competitive interactions of molecular adaptors.
17135396 2007 Compartmentalization of cAMP-dependent signaling by phosphodiesterase-4D is involved in the regulation of vasopressin-mediated water reabsorption in renal principal cells.
17088426 2006 PGE(1) stimulation of HEK293 cells generates multiple contiguous domains with different [cAMP]: role of compartmentalized phosphodiesterases.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17065074 2006 cAMP phosphodiesterase activity evaluation in human carcinoma of salivary glands.
17016624 2006 Association of phosphodiesterase 4D gene polymorphisms with chronic obstructive pulmonary disease: relationship to interleukin 13 gene polymorphism.
17006457 2006 Many hypotheses but no replication for the association between PDE4D and stroke.
16973330 2006 Oxidative stress employs phosphatidyl inositol 3-kinase and ERK signalling pathways to activate cAMP phosphodiesterase-4D3 (PDE4D3) through multi-site phosphorylation at Ser239 and Ser579.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16914755 2006 Association between phosphodiesterase 4D gene and ischaemic stroke.
16835261 2006 Phosphodiesterase 4D polymorphisms and the risk of cerebral infarction in a biracial population: the Stroke Prevention in Young Women Study.
16825591 2006 Polymorphisms of the phosphodiesterase 4D, cAMP-specific (PDE4D) gene and risk of ischemic stroke: a prospective, nested case-control evaluation.
16689683 2006 Scanning peptide array analyses identify overlapping binding sites for the signalling scaffold proteins, beta-arrestin and RACK1, in cAMP-specific phosphodiesterase PDE4D5.
16675738 2006 Association of phosphodiesterase 4D polymorphisms with ischemic stroke in a US population stratified by hypertension status.
16642035 2006 An anchored PKA and PDE4 complex regulates subplasmalemmal cAMP dynamics.
16543535 2006 Evaluation of single nucleotide polymorphisms in the phosphodiesterase 4D gene (PDE4D) and their association with ischaemic stroke in a large German cohort.
16539372 2006 Enantiomer discrimination illustrated by the high resolution crystal structures of type 4 phosphodiesterase.
16373644 2006 Association of Phosphodiesterase 4D with ischemic stroke: a population-based case-control study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16322495 2006 Genotype and haplotype association study of the STRK1 region on 5q12 among Japanese: a case-control study.
16213210 2005 Phosphodiesterase 4D deficiency in the ryanodine-receptor complex promotes heart failure and arrhythmias.
16177794 2005 The protein kinase A anchoring protein mAKAP coordinates two integrated cAMP effector pathways.
16166573 2005 Association of phosphodiesterase 4D gene with ischemic stroke in a Pakistani population.
16162858 2005 Familial aggregation, the PDE4D gene, and ischemic stroke in a genetically isolated population.
16130105 2005 Phosphodiesterase 4D and 5-lipoxygenase activating protein in ischemic stroke.
16030021 2005 RNA silencing identifies PDE4D5 as the functionally relevant cAMP phosphodiesterase interacting with beta arrestin to control the protein kinase A/AKAP79-mediated switching of the beta2-adrenergic receptor to activation of ERK in HEK293B2 cells.
16020760 2005 Linkage of ischemic stroke to the PDE4D region on 5q in a Swedish population.
15938621 2005 Structural determinants for inhibitor specificity and selectivity in PDE2A using the wheat germ in vitro translation system.
15861005 2005 Molecular genetics of coronary artery disease.
15802632 2005 Phosphodiesterase 4D gene, ischemic stroke, and asymptomatic carotid atherosclerosis.
15752431 2005 Association between a variation in the phosphodiesterase 4D gene and bone mineral density.
15731479 2005 ALOX5AP gene and the PDE4D gene in a central European population of stroke patients.
15685167 2005 A family of phosphodiesterase inhibitors discovered by cocrystallography and scaffold-based drug design.
15611099 2005 Phosphodiesterase 4D forms a cAMP diffusion barrier at the apical membrane of the airway epithelium.
15576036 2004 Structural basis for the activity of drugs that inhibit phosphodiesterases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15260978 2004 A glutamine switch mechanism for nucleotide selectivity by phosphodiesterases.
15182229 2004 PKA-phosphorylation of PDE4D3 facilitates recruitment of the mAKAP signalling complex.
15131123 2004 The oligomerization state determines regulatory properties and inhibitor sensitivity of type 4 cAMP-specific phosphodiesterases.
15003452 2004 Crystal structures of the catalytic domain of phosphodiesterase 4B complexed with AMP, 8-Br-AMP, and rolipram.
14668322 2004 Crystal structures of phosphodiesterases 4 and 5 in complex with inhibitor 3-isobutyl-1-methylxanthine suggest a conformation determinant of inhibitor selectivity.
14609333 2003 The crystal structure of AMP-bound PDE4 suggests a mechanism for phosphodiesterase catalysis.
14517540 2003 The gene encoding phosphodiesterase 4D confers risk of ischemic stroke.
14517535 2003 Genetics of common polygenic stroke.
14500724 2003 The unique amino-terminal region of the PDE4D5 cAMP phosphodiesterase isoform confers preferential interaction with beta-arrestins.
12842049 2003 Three-dimensional structures of PDE4D in complex with roliprams and implication on inhibitor selectivity.
12834813 2003 Cloning and characterization of novel PDE4D isoforms PDE4D6 and PDE4D7.
12552097 2003 beta-Arrestin-mediated PDE4 cAMP phosphodiesterase recruitment regulates beta-adrenoceptor switching from Gs to Gi.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399592 2002 Targeting of cyclic AMP degradation to beta 2-adrenergic receptors by beta-arrestins.
12387865 2002 Crystal structure of phosphodiesterase 4D and inhibitor complex(1).
12193273 2002 Delineation of RAID1, the RACK1 interaction domain located within the unique N-terminal region of the cAMP-specific phosphodiesterase, PDE4D5.
12121997 2002 Cyclic AMP-dependent transcriptional up-regulation of phosphodiesterase 4D5 in human airway smooth muscle cells. Identification and characterization of a novel PDE4D5 promoter.
11839681 2002 Inhibition of PDE3B augments PDE4 inhibitor-induced apoptosis in a subset of patients with chronic lymphocytic leukemia.
11833004 2002 Localization of a susceptibility gene for common forms of stroke to 5q12.
11516626 2001 Identification of a surface on the beta-propeller protein RACK1 that interacts with the cAMP-specific phosphodiesterase PDE4D5.
11296225 2001 mAKAP assembles a protein kinase A/PDE4 phosphodiesterase cAMP signaling module.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
11134006 2001 Myomegalin is a novel protein of the golgi/centrosome that interacts with a cyclic nucleotide phosphodiesterase.
10913353 2000 Phosphodiesterases 4D and 7A splice variants in the response of HUVEC cells to TNF-alpha(1).
10828059 2000 ERK2 mitogen-activated protein kinase binding, phosphorylation, and regulation of the PDE4D cAMP-specific phosphodiesterases. The involvement of COOH-terminal docking sites and NH2-terminal UCR regions.
10329691 1999 The RACK1 signaling scaffold protein selectively interacts with the cAMP-specific phosphodiesterase PDE4D5 isoform.
10022832 1999 The MAP kinase ERK2 inhibits the cyclic AMP-specific phosphodiesterase HSPDE4D3 by phosphorylating it at Ser579.
9371714 1997 Molecular cloning and transient expression in COS7 cells of a novel human PDE4B cAMP-specific phosphodiesterase, HSPDE4B3.
9371713 1997 Characterization of five different proteins produced by alternatively spliced mRNAs from the human cAMP-specific phosphodiesterase PDE4D gene.
8797812 1996 Identification of cyclic AMP-phosphodiesterase variants from the PDE4D gene expressed in human peripheral mononuclear cells.
8663227 1996 Phosphorylation and activation of a cAMP-specific phosphodiesterase by the cAMP-dependent protein kinase. Involvement of serine 54 in the enzyme activation.
8413254 1993 A family of human phosphodiesterases homologous to the dunce learning and memory gene product of Drosophila melanogaster are potential targets for antidepressant drugs.
8125310 1994 Isolation of a cDNA encoding a human rolipram-sensitive cyclic AMP phosphodiesterase (PDE IVD).
8009369 1994 Chromosome localizations of genes for five cAMP-specific phosphodiesterases in man and mouse.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.
2554303 1989 The mRNA encoding a high-affinity cAMP phosphodiesterase is regulated by hormones and cAMP.