Property Summary

Ligand Count 524
NCBI Gene PubMed Count 59
PubMed Score 1256.89
PubTator Score 691.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis -1.700 2.0e-04
adrenocortical carcinoma -1.128 4.2e-03
adult high grade glioma -1.600 2.4e-04
astrocytic glioma -1.100 1.7e-03
atypical teratoid / rhabdoid tumor -1.700 2.8e-04
ependymoma -1.400 1.3e-08
fibroadenoma -1.100 4.0e-02
glioblastoma -1.200 1.8e-03
group 3 medulloblastoma -3.100 5.0e-07
invasive ductal carcinoma -1.100 3.1e-02
malignant mesothelioma 1.800 2.9e-07
medulloblastoma, large-cell -3.200 2.7e-06
osteosarcoma -1.020 2.0e-02
ovarian cancer 1.300 2.0e-03
primitive neuroectodermal tumor -2.100 1.2e-04
tuberculosis -1.200 1.4e-05

 MGI Phenotype (1)

Gene RIF (46)

AA Sequence

MEPPTVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAERAERERQPHRPIERADA      1 - 70
MDTSDRPGLRTTRMSWPSSFHGTGTGSGGAGGGSSRRFEAENGPTPSPGRSPLDSQASPGLVLHAGAATS     71 - 140
QRRESFLYRSDSDYDMSPKTMSRNSSVTSEAHAEDLIVTPFAQVLASLRSVRSNFSLLTNVPVPSNKRSP    141 - 210
LGGPTPVCKATLSEETCQQLARETLEELDWCLEQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSG    211 - 280
NQVSEYISTTFLDKQNEVEIPSPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNS    281 - 350
NIPRFGVKTDQEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYML    351 - 420
TLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGVSNQFLINTNS    421 - 490
ELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTMV    491 - 560
ETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLELYRQWTDRIMAEFFQQGDRERERGMEISPM    561 - 630
CDKHTASVEKSQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGH    631 - 700
PPLPDKFQFELTLEEEEEEEISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQESLEVMAQEASL    701 - 770
EAELEAVYLTQQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLP    771 - 840
STAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT                            841 - 886
//

Text Mined References (65)

PMID Year Title