Property Summary

NCBI Gene PubMed Count 50
PubMed Score 124.29
PubTator Score 92.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Heart conduction disease 65 0.0 1.0
Rheumatoid Arthritis 1170 0.0 1.0
Disease Target Count Z-score Confidence
Brachydactyly 52 4.068 2.0
Impotence 45 3.207 1.6

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma 1.800 9.5e-03
medulloblastoma, large-cell -1.300 4.3e-03
intraductal papillary-mucinous adenoma (... -2.800 2.0e-04
intraductal papillary-mucinous neoplasm ... -3.000 6.1e-05
colon cancer -2.900 6.8e-05
diabetes mellitus -1.200 2.6e-02
interstitial cystitis 1.200 8.9e-04
group 4 medulloblastoma -1.500 4.6e-04
pilocytic astrocytoma -1.100 4.2e-03
gastric carcinoma 1.600 4.5e-02
invasive ductal carcinoma -1.200 2.3e-02
ulcerative colitis -1.400 6.2e-04

Gene RIF (26)

PMID Text
26205238 Chemical proteomics results show that besides known interactors such as 14-3-3 family proteins, PDE3A was found to associate with a PP2A complex composed of a regulatory, scaffold and catalytic subunit.
26095046 Epigenetic regulation of phosphodiesterases 2A and 3A underlies compromised beta-adrenergic Signaling in an induced pluripotent stem cell model of dilated cardiomyopathy.
25961942 A heterozygous missense mutation in PDE3A causes autosomal dominant hypertension with brachydactyly.
25593322 PDE3A is part of a SERCA2 signaling complex in cardiac myocytes.
25403996 We found a highly significant association between PDE3A-SLCO1C1 and the clinical response to TNF blockers
24604378 the genotypic and allelic frequencies of the rs7134375 SNP are different between the Mulao and Han populations. the PDE3A rs7134375 SNP is associated with serum TG levels in the Mulao population, however, not in the Han population.
23651021 The PDE3A-SLCO1C1 locus rs3794271 SNP showed a highly significant association with anti-TNF treatment response.
23008439 PI3Kgamma coordinates the coincident signaling of the major cardiac PDE3 and PDE4 isoforms, thus orchestrating a feedback loop that prevents calcium-dependent ventricular arrhythmia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20586925 Anagrelide suppresses megakaryocytopoiesis by reducing the expression levels of GATA-1 and FOG-1 via a PDEIII-independent mechanism that is differentiation context-specific and does not involve inhibition of MPL-mediated early signal transduction events
20089840 Data show that PDE3A inhibition augments CFTR-dependent submucosal gland secretion and actin skeleton disruption decreases secretion.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19478329 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19261611 platelet activation stimulates PKC-dependent phosphorylation of PDE3A on Ser(312), Ser(428), Ser(438), Ser(465), and Ser(492) leading to a subsequent increase in cAMP hydrolysis and 14-3-3 binding.
17392505 activation/phosphorylation of PDE3A via Akt signaling pathway participates in regulating cAMP during thrombin activation of platelets.
17332439 The positive-feedback loop described in this review is regulated by phosphodiesterase 3A and inducible cAMP early repressor (ICER) and is pathologically important in adult hearts.
16873361 structure-function analysis of the catalytic region of human platelet phosphodiesterase 3A
16172121 cGMP may amplify cAMP-mediated signaling in intracellular compartments of myocardium by PDE3-dependent and PDE3-independent mechanisms.
16153182 14-3-3 Proteins can discriminate between sites in a region of multisite phosphorylation on PDE3A; the cytoskeletal cross-linker protein plectin-1 coimmunoprecipitated with PDE3A independently of 14-3-3 binding.
15041473 PDE3, but not of PDE5, extends to all major processes in thrombus formation: assembly of platelets into aggregates, secretion of autocrine products, and procoagulant activity.
12773402 Presence of phosphodiesterase type 3 A (PDE 3A) mRNA was confirmed in human germinal vesicle-stage (GV) oocytes. A selective PDE 3 inhibitor, Org 9935, arrested oocytes retrieved from immature follicles in prophase I for up to 72 h.
12466227 PDE3A gene transcript levels are increased in the intrapulmonary and resistance pulmonary arteries by chronic hypoxia.
12154085 These findings suggest that alternative processing of the PDE3A gene results in the generation of two mRNAs and three protein isoforms in cardiac myocytes that differ in intracellular localization and may be regulated through different signaling pathways.
12038792 There was a concentration-dependent inhibition in the increase of intracellular Ca2+ with PDE3 inhibition and significantly less with PDE2 inhibition.
11156964 HIV-1 Tat decreases the intracellular levels of cAMP and CREB ser-133 phosphorylation through a signal transduction pathway involving sequential activation of phosphatidylinositol 3-kinase, AKT, and cyclic nucleoside phosphodiesterases

AA Sequence

MAVPGDAARVRDKPVHSGVSQAPTAGRDCHHRADPASPRDSGCRGCWGDLVLQPLRSSRKLSSALCAGSL      1 - 70
SFLLALLVRLVRGEVGCDLEQCKEAAAAEEEEAAPGAEGGVFPGPRGGAPGGGARLSPWLQPSALLFSLL     71 - 140
CAFFWMGLYLLRAGVRLPLAVALLAACCGGEALVQIGLGVGEDHLLSLPAAGVVLSCLAAATWLVLRLRL    141 - 210
GVLMIALTSAVRTVSLISLERFKVAWRPYLAYLAGVLGILLARYVEQILPQSAEAAPREHLGSQLIAGTK    211 - 280
EDIPVFKRRRRSSSVVSAEMSGCSSKSHRRTSLPCIPREQLMGHSEWDHKRGPRGSQSSGTSITVDIAVM    281 - 350
GEAHGLITDLLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSDSEESSEKDKLA    351 - 420
IPKRLRRSLPPGLLRRVSSTWTTTTSATGLPTLEPAPVRRDRSTSIKLQEAPSSSPDSWNNPVMMTLTKS    421 - 490
RSFTSSYAISAANHVKAKKQSRPGALAKISPLSSPCSSPLQGTPASSLVSKISAVQFPESADTTAKQSLG    491 - 560
SHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNN    561 - 630
SDSSDIVQNEDETECLREPLRKASACSTYAPETMMFLDKPILAPEPLVMDNLDSIMEQLNTWNFPIFDLV    631 - 700
ENIGRKCGRILSQVSYRLFEDMGLFEAFKIPIREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQ    701 - 770
PIPGLSTVINDHGSTSDSDSDSGFTHGHMGYVFSKTYNVTDDKYGCLSGNIPALELMALYVAAAMHDYDH    771 - 840
PGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLINLDHVEFKHFRFLVIEAILATDL    841 - 910
KKHFDFVAKFNGKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKELHLQWTDGIVNEFYEQGDEEA    911 - 980
SLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDSAGLMPGKWVEDSDESGDTDDPEEEEEEAPAPN    981 - 1050
EEETCENNESPKKKTFKRRKIYCQITQHLLQNHKMWKKVIEEEQRLAGIENQSLDQTPQSHSSEQIQAIK   1051 - 1120
EEEEEKGKPRGEEIPTQKPDQ                                                    1121 - 1141
//

Text Mined References (54)

PMID Year Title
26205238 2015 Charting the interactome of PDE3A in human cells using an IBMX based chemical proteomics approach.
26095046 2015 Epigenetic Regulation of Phosphodiesterases 2A and 3A Underlies Compromised ?-Adrenergic Signaling in an iPSC Model of Dilated Cardiomyopathy.
25961942 2015 PDE3A mutations cause autosomal dominant hypertension with brachydactyly.
25593322 2015 Regulation of sarcoplasmic reticulum Ca2+ ATPase 2 (SERCA2) activity by phosphodiesterase 3A (PDE3A) in human myocardium: phosphorylation-dependent interaction of PDE3A1 with SERCA2.
25403996 2015 Association of the PDE3A-SLCO1C1 locus with the response to anti-TNF agents in psoriasis.
24604378 2014 Phosphodiesterase 3A rs7134375 single nucleotide polymorphism and serum lipid levels.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23651021 2013 GWAS replication study confirms the association of PDE3A-SLCO1C1 with anti-TNF therapy response in rheumatoid arthritis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23008439 2012 Phosphoinositide 3-kinase ? protects against catecholamine-induced ventricular arrhythmia through protein kinase A-mediated regulation of distinct phosphodiesterases.
22569225 2012 Investigation of single nucleotide polymorphisms and biological pathways associated with response to TNF? inhibitors in patients with rheumatoid arthritis.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
21844884 2013 Genome-wide meta-analysis identifies variants associated with platinating agent susceptibility across populations.
21269460 2011 Initial characterization of the human central proteome.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20586925 2010 Anagrelide represses GATA-1 and FOG-1 expression without interfering with thrombopoietin receptor signal transduction.
20089840 2010 Compartmentalized cyclic adenosine 3',5'-monophosphate at the plasma membrane clusters PDE3A and cystic fibrosis transmembrane conductance regulator into microdomains.
20031603 2009 A genome-wide association scan of RR and QT interval duration in 3 European genetically isolated populations: the EUROSPAN project.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
19478329 Genome-wide study of single-nucleotide polymorphisms associated with azoospermia and severe oligozoospermia.
19261611 2009 Protein kinase C-mediated phosphorylation and activation of PDE3A regulate cAMP levels in human platelets.
19252089 2009 Iloprost- and isoproterenol-induced increases in cAMP are regulated by different phosphodiesterases in erythrocytes of both rabbits and humans.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18088087 2008 Phosphoproteome of resting human platelets.
17704206 2007 Differential regulation of endothelial cell permeability by cGMP via phosphodiesterases 2 and 3.
17392505 2007 Thrombin regulates intracellular cyclic AMP concentration in human platelets through phosphorylation/activation of phosphodiesterase 3A.
17332439 2007 Regulation of phosphodiesterase 3 and inducible cAMP early repressor in the heart.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16873361 2006 New insights from the structure-function analysis of the catalytic region of human platelet phosphodiesterase 3A: a role for the unique 44-amino acid insert.
16172121 2005 Isoforms of cyclic nucleotide phosphodiesterase PDE3 and their contribution to cAMP hydrolytic activity in subcellular fractions of human myocardium.
16153182 2005 Phosphodiesterase 3A binds to 14-3-3 proteins in response to PMA-induced phosphorylation of Ser428.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15041473 2004 Control of platelet activation by cyclic AMP turnover and cyclic nucleotide phosphodiesterase type-3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12773402 2003 Human oocytes reversibly arrested in prophase I by phosphodiesterase type 3 inhibitor in vitro.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466227 2002 Increased expression of the cGMP-inhibited cAMP-specific (PDE3) and cGMP binding cGMP-specific (PDE5) phosphodiesterases in models of pulmonary hypertension.
12154085 2002 Isoforms of cyclic nucleotide phosphodiesterase PDE3A in cardiac myocytes.
12038792 2002 Differential regulation of human platelet responses by cGMP inhibited and stimulated cAMP phosphodiesterases.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
11115397 2001 Identification of a novel isoform of the cyclic-nucleotide phosphodiesterase PDE3A expressed in vascular smooth-muscle myocytes.
10679291 2000 Cardiac type cGMP-inhibited phosphodiesterase (PDE3A) gene structure: similarity and difference to adipocyte type PDE3B gene.
10421499 1999 Molecular biological characterization of phosphodiesterase 3A from human corpus cavernosum.
9173884 1997 Expression and mutagenesis of the catalytic domain of cGMP-inhibited phosphodiesterase (PDE3) cloned from human platelets.
8921398 1996 Molecular cloning and chromosomal assignment of the human homologue of the rat cGMP-inhibited phosphodiesterase 1 (PDE3A)--a gene involved in fat metabolism located at 11p 15.1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8695850 1996 Human platelet cGI-PDE: expression in yeast and localization of the catalytic domain by deletion mutagenesis.
8557689 1996 Isolation and characterization of cDNAs corresponding to two human calcium, calmodulin-regulated, 3',5'-cyclic nucleotide phosphodiesterases.
8155697 1994 Single-step affinity purification, partial structure and properties of human platelet cGMP inhibited cAMP phosphodiesterase.
1315035 1992 Molecular cloning and expression of human myocardial cGMP-inhibited cAMP phosphodiesterase.