Property Summary

Ligand Count 484
NCBI Gene PubMed Count 36
PubMed Score 64.64
PubTator Score 41.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.700 2.1e-02
astrocytic glioma -1.500 2.9e-03
Astrocytoma, Pilocytic -1.900 8.3e-04
atypical teratoid / rhabdoid tumor -3.500 3.9e-10
breast carcinoma -2.300 1.4e-05
ductal carcinoma in situ -2.200 2.4e-04
ependymoma -2.700 1.8e-02
fibroadenoma -1.600 2.2e-02
glioblastoma -2.100 2.3e-06
intraductal papillary-mucinous neoplasm ... -1.200 8.1e-03
invasive ductal carcinoma -3.200 2.8e-04
lung adenocarcinoma -1.500 4.2e-11
medulloblastoma -1.600 8.6e-03
medulloblastoma, large-cell -2.000 1.8e-02
non-inflammatory breast cancer -1.600 4.2e-05
non-small cell lung cancer -1.815 7.3e-25
oligodendroglioma -1.900 1.5e-14
osteosarcoma -1.299 3.1e-02
Pick disease -1.200 3.8e-03
primitive neuroectodermal tumor -2.700 3.2e-04
tuberculosis -2.200 3.1e-07

 MGI Phenotype (1)

 GWAS Trait (1)

PDB (25)

Gene RIF (19)

AA Sequence

MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDISGLQRAVKEA      1 - 70
LSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCNGLGFSDLPGKPLARLVAPLA     71 - 140
PDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVALRRVQVLQQRGPREAPRAVQNPP    141 - 210
EGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIG    211 - 280
DKVLGEEVSFPLTGCLGQVVEDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAF    281 - 350
NKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE    351 - 420
ARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRG    421 - 490
VDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEA    491 - 560
QYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFIN    561 - 630
NYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDH    631 - 700
RGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDL    701 - 770
AHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM    771 - 840
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSN    841 - 910
NSLDFLDEEYEVPDLDGTRAPINGCCSLDAE                                           911 - 941
//

Text Mined References (40)

PMID Year Title