Property Summary

NCBI Gene PubMed Count 34
PubMed Score 58.10
PubTator Score 41.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytoma -2.500 9.1e-03
posterior fossa group B ependymoma -3.000 9.8e-11
glioblastoma -3.200 6.0e-05
oligodendroglioma -1.900 1.5e-14
osteosarcoma -1.299 3.1e-02
sonic hedgehog group medulloblastoma -2.600 1.5e-03
atypical teratoid / rhabdoid tumor -3.500 3.9e-10
medulloblastoma, large-cell -2.000 1.8e-02
primitive neuroectodermal tumor -2.700 3.2e-04
tuberculosis and treatment for 3 months -2.300 1.1e-06
non-small cell lung cancer -1.815 7.3e-25
intraductal papillary-mucinous neoplasm ... -1.200 8.1e-03
breast carcinoma -2.300 1.4e-05
fibroadenoma -1.600 2.2e-02
pediatric high grade glioma -2.400 1.3e-04
pilocytic astrocytoma -1.900 1.0e-03
lung adenocarcinoma -1.500 4.2e-11
non-inflammatory breast cancer -1.600 4.2e-05
Pick disease -1.200 3.8e-03
ductal carcinoma in situ -2.200 2.4e-04
invasive ductal carcinoma -3.200 2.8e-04

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (18)

PMID Text
26095046 Epigenetic regulation of phosphodiesterases 2A and 3A underlies compromised beta-adrenergic Signaling in an induced pluripotent stem cell model of dilated cardiomyopathy.
25941078 Lu AF33241 represents a novel PDE2A/PDE10A inhibitor tool which can penetrate the blood brain barrier.
25230992 curcumin exerts its in vitro anti-angiogenic and in vivo anti-tumour properties through combined PDE2 and PDE4 inhibition
24705027 PDE2A is involved in growth and invasion of human malignant melanoma PMP cells.
23899287 This study reports the X-ray crystal structure of PDE2A in complex with a highly selective, nanomolar inhibitor (BAY60-7550) at 1.9 A resolution, and the structure of apo PDE2 at 2.0 A resolution.
23810893 PDE2 overexpression in healthy cardiomyocytes reduces the rise in cyclic AMP levels and L-type calcium current amplitude, and abolishes the inotropic effect following acute beta-adrenergic receptor stimulation.
23381931 Our results demonstrated that the PDE2A2 variant carrying point mutations is expressed in PMP cells and may affect cell cycle progression by modulating cyclin A expression.
21766240 Active site similarity between human and Plasmodium falciparum phosphodiesterases: considerations for antimalarial drug design
21724846 the phosphodiesterase 2A isoform localized to mitochondria regulates respiration
21697861 found in smooth muscle wall of blood vessels transversing the clitoral supepithelial and stromal space
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19828435 report the X-ray crystal structures of a PDE protein that includes both catalytic and regulatory domains, namely, PDE2A containing the N-terminal GAF domains and the catalytic domain.
19390057 Phosphodiesterase 2 mediates redox-sensitive endothelial cell proliferation and angiogenesis by thrombin via Rac1 and NADPH oxidase 2.
15650061 TNF-alpha-mediated up-regulation of PDE2 may destabilize endothelial barrier function in sepsis
12038792 Inhibition of PDE2 resulted in higher levels of intracellular cAMP than inhibition of PDE3A suggesting this PDE may be the more important regulator of cAMP in human platelets.
11156964 HIV-1 Tat decreases the intracellular levels of cAMP and CREB ser-133 phosphorylation through a signal transduction pathway involving sequential activation of phosphatidylinositol 3-kinase, AKT, and cyclic nucleoside phosphodiesterases

AA Sequence

MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDISGLQRAVKEA      1 - 70
LSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCNGLGFSDLPGKPLARLVAPLA     71 - 140
PDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVALRRVQVLQQRGPREAPRAVQNPP    141 - 210
EGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIG    211 - 280
DKVLGEEVSFPLTGCLGQVVEDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAF    281 - 350
NKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE    351 - 420
ARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRG    421 - 490
VDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEA    491 - 560
QYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFIN    561 - 630
NYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDH    631 - 700
RGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDL    701 - 770
AHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM    771 - 840
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSN    841 - 910
NSLDFLDEEYEVPDLDGTRAPINGCCSLDAE                                           911 - 941
//

Text Mined References (38)

PMID Year Title
26095046 2015 Epigenetic Regulation of Phosphodiesterases 2A and 3A Underlies Compromised ?-Adrenergic Signaling in an iPSC Model of Dilated Cardiomyopathy.
25941078 2015 Characterisation of Lu AF33241: A novel, brain-penetrant, dual inhibitor of phosphodiesterase (PDE) 2A and PDE10A.
25230992 2015 Tumour growth inhibition and anti-angiogenic effects using curcumin correspond to combined PDE2 and PDE4 inhibition.
24705027 2014 Role of phosphodiesterase 2 in growth and invasion of human malignant melanoma cells.
23899287 2013 X-ray crystal structure of phosphodiesterase 2 in complex with a highly selective, nanomolar inhibitor reveals a binding-induced pocket important for selectivity.
23810893 2013 Phosphodiesterase-2 is up-regulated in human failing hearts and blunts ?-adrenergic responses in cardiomyocytes.
23381931 2013 Characterization of phosphodiesterase 2A in human malignant melanoma PMP cells.
22446963 2012 Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population.
21766240 2011 Active site similarity between human and Plasmodium falciparum phosphodiesterases: considerations for antimalarial drug design.
21724846 2011 A phosphodiesterase 2A isoform localized to mitochondria regulates respiration.
21697861 Expression and distribution of key enzymes of the cyclic GMP signaling in the human clitoris: relation to phosphodiesterase type 5 (PDE5).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20395239 2010 Genome-wide association identifies ATOH7 as a major gene determining human optic disc size.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19828435 2009 Mechanism for the allosteric regulation of phosphodiesterase 2A deduced from the X-ray structure of a near full-length construct.
19689430 2009 Binding of cyclic nucleotides to phosphodiesterase 10A and 11A GAF domains does not stimulate catalytic activity.
19632989 2009 Dual acylation of PDE2A splice variant 3: targeting to synaptic membranes.
19506089 2009 Immunohistochemical localization of phosphodiesterase 2A in multiple mammalian species.
19390057 2009 Phosphodiesterase 2 mediates redox-sensitive endothelial cell proliferation and angiogenesis by thrombin via Rac1 and NADPH oxidase 2.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19252089 2009 Iloprost- and isoproterenol-induced increases in cAMP are regulated by different phosphodiesterases in erythrocytes of both rabbits and humans.
17704206 2007 Differential regulation of endothelial cell permeability by cGMP via phosphodiesterases 2 and 3.
17329248 2007 Phosphodiesterase 2A forms a complex with the co-chaperone XAP2 and regulates nuclear translocation of the aryl hydrocarbon receptor.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15938621 2005 Structural determinants for inhibitor specificity and selectivity in PDE2A using the wheat germ in vitro translation system.
15650061 2005 Tumor necrosis factor-alpha-dependent expression of phosphodiesterase 2: role in endothelial hyperpermeability.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14687666 2004 Differentiation of human monocytes in vitro with granulocyte-macrophage colony-stimulating factor and macrophage colony-stimulating factor produces distinct changes in cGMP phosphodiesterase expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12271124 2002 The two GAF domains in phosphodiesterase 2A have distinct roles in dimerization and in cGMP binding.
12038792 2002 Differential regulation of human platelet responses by cGMP inhibited and stimulated cAMP phosphodiesterases.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
10375378 1999 Differential expression of the cyclic GMP-stimulated phosphodiesterase PDE2A in human venous and capillary endothelial cells.
9210593 1997 Isolation and characterization of human cDNAs encoding a cGMP-stimulated 3',5'-cyclic nucleotide phosphodiesterase.
8557689 1996 Isolation and characterization of cDNAs corresponding to two human calcium, calmodulin-regulated, 3',5'-cyclic nucleotide phosphodiesterases.