Property Summary

Ligand Count 14
NCBI Gene PubMed Count 23
PubMed Score 21.07
PubTator Score 16.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.133 1.8e-02

Gene RIF (6)

AA Sequence

MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNLEYTASLLEAV      1 - 70
YIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKPKFRSIVHAVQAGIFVERMFR     71 - 140
RTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHALRTIVFELLTRHNLISRFKIPTVFLMSFLDA    141 - 210
LETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKS    211 - 280
ECAIVYNDRSVLENHHISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTAL    281 - 350
QQLERIDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS    351 - 420
QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQ    421 - 490
ENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD                            491 - 536
//

Text Mined References (25)

PMID Year Title