Property Summary

NCBI Gene PubMed Count 28
PubMed Score 18.14
PubTator Score 23.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Gene RIF (15)

PMID Text
26464516 Report significant associations of PDE1A single nucleotide polymorphisms with diastolic blood pressure and carotid intima-media thickness.
22012077 These results suggest that induction of PDE1A plays a critical role in cardiac fibroblast activation and cardiac fibrosis
20807569 PDE1A is suggested to be involved in epigenetic mechanisms by targeting the epigenetic integrator UHRF1.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20110084 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19557111 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19214142 PDE1A is unlikely to play an important role in antidepressant outcome in this sample
19214142 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18043711 Variants in PDE1A are not associated with citalopram response in patient with depression.
16514069 PDE1A is important in VSMC growth and survival and may contribute to the neointima formation in atherosclerosis and restenosis.
15272012 Ca2+-calmodulin-dependent phosphodiesterase 1A is activated by sustained entry of Ca2+
12135876 PDE1A is permanently activated in human spermatozoa
11156964 HIV-1 Tat decreases the intracellular levels of cAMP and CREB ser-133 phosphorylation through a signal transduction pathway involving sequential activation of phosphatidylinositol 3-kinase, AKT, and cyclic nucleoside phosphodiesterases

AA Sequence

MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAASVLEAVYIDE      1 - 70
TRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRSIVHAVQAGIFVERMYRKTYH     71 - 140
MVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMIYELFTRYDLINRFKIPVSCLITFAEALEVG    141 - 210
YSKYKNPYHNLIHAADVTQTVHYIMLHTGIMHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAI    211 - 280
LYNDRSVLENHHVSAAYRLMQEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPE    281 - 350
GIDRAKTMSLILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF    351 - 420
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGSMSDGSYSPDY    421 - 490
SLAAVDLKSFKNNLVDIIQQNKERWKELAAQEARTSSQKCEFIHQ                             491 - 535
//

Text Mined References (29)

PMID Year Title
26464516 2015 Phosphodiesterase 1 regulation is a key mechanism in vascular aging.
22012077 2011 Cyclic nucleotide phosphodiesterase 1A: a key regulator of cardiac fibroblast activation and extracellular matrix remodeling in the heart.
21844884 2013 Genome-wide meta-analysis identifies variants associated with platinating agent susceptibility across populations.
20807569 2011 Down-regulation of cyclic nucleotide phosphodiesterase PDE1A is the key event of p73 and UHRF1 deregulation in thymoquinone-induced acute lymphoblastic leukemia cell apoptosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20110084 2010 Failure to replicate genetic associations with antidepressant treatment response in duloxetine-treated patients.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19557111 2009 Association of PDE11A global haplotype with major depression and antidepressant drug response.
19214142 2009 Association study of phosphodiesterase genes in the Sequenced Treatment Alternatives to Relieve Depression sample.
18335582 2008 Kinetic properties of Ca2+/calmodulin-dependent phosphodiesterase isoforms dictate intracellular cAMP dynamics in response to elevation of cytosolic Ca2+.
18043711 2007 Variants in PDE11A and PDE1A are not associated with citalopram response.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17726023 2007 Cyclic nucleotide phosphodiesterase PDE1C1 in human cardiac myocytes.
16514069 2006 Role of nuclear Ca2+/calmodulin-stimulated phosphodiesterase 1A in vascular smooth muscle cell growth and survival.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15272012 2004 Sustained entry of Ca2+ is required to activate Ca2+-calmodulin-dependent phosphodiesterase 1A.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12135876 2002 Presence of cyclic nucleotide phosphodiesterases PDE1A, existing as a stable complex with calmodulin, and PDE3A in human spermatozoa.
11991719 2002 Cloning and characterization of a novel apolipoprotein A-I binding protein, AI-BP, secreted by cells of the kidney proximal tubules in response to HDL or ApoA-I.
11747989 2002 Isolation and differential tissue distribution of two human cDNAs encoding PDE1 splice variants.
11369604 2001 Stage and cell-specific expression of calmodulin-dependent phosphodiesterases in mouse testis.
11342109 2001 Human Ca2+/calmodulin-dependent phosphodiesterase PDE1A: novel splice variants, their specific expression, genomic organization, and chromosomal localization.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
10405764 1999 Isolation, expression and analysis of splice variants of a human Ca2+/calmodulin-stimulated phosphodiesterase (PDE1A).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8557689 1996 Isolation and characterization of cDNAs corresponding to two human calcium, calmodulin-regulated, 3',5'-cyclic nucleotide phosphodiesterases.