Property Summary

NCBI Gene PubMed Count 45
PubMed Score 37.24
PubTator Score 49.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.600 3.2e-03
breast carcinoma -1.200 1.9e-03
Breast cancer -1.100 4.7e-06
ductal carcinoma in situ -1.600 1.2e-03
invasive ductal carcinoma -1.900 1.8e-03
pituitary cancer -1.700 4.5e-06
psoriasis -1.100 2.3e-11

Gene RIF (34)

PMID Text
26820475 One percent of the Swedish population carries a PDE11A loss-of-function mutation which is associated with elevated BP, abdominal obesity, and risk of ischemic stroke.
26459559 Testicular germ cell tumors had 55 PDE11A variants: 20 missense (10 new, 9 in transcript variant 4, 1 in transcript variant 3), 4 splice-site, 2 nonsense, 7 synonymous, and 22 intronic. p.F258Y, p.G291R, p.V820M, p.R545X, and p.K568R were only in cases.
22996146 PDE11A genetic variants may increase predisposition to ACTH-independent macronodular adrenal hyperplasia.
21697861 found in single nerve trunks in the clitoral stroma
21047926 We demonstrate, in a large cohort of Carney Complex patients, a high frequency of PDE11A variants, suggesting that PDE11A is a genetic modifying factor for the development of testicular and adrenal tumors in patients with germline PRKAR1A mutation.
21047926 Observational study of gene-disease association. (HuGE Navigator)
20920776 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20920776 PDE11A SNP assocaited with allergic asthma.
20881257 Our data suggest that, like in the adrenal cortex and the testicular germ cells, PDE11A-inactivating genetic alterations may play a role in susceptibility to prostate cancer
20881257 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
20110084 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19689430 Binding of cyclic nucleotides to phosphodiesterase 10A and 11A GAF domains does not stimulate catalytic activity.
19671705 Immunohistochemistry revealed PDE11A expression higher in somatotropinomas than in normal somatotrophs, without significant difference between tumors with or without PDE11A variants.
19671705 Observational study of gene-disease association. (HuGE Navigator)
19557111 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19549888 PDE11A-inactivating sequence variants may modify the risk of familial and bilateral testicular germ cell tumors.
19549888 Observational study of gene-disease association. (HuGE Navigator)
19429701 Observational study of gene-disease association. (HuGE Navigator)
19214142 PDE11A, is unlikely to play an important role in antidepressant outcome in this sample
19214142 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18559625 PDE11A sequence defects predispose to a variety of lesions (beyond micronodular adrenocortical hyperplasia).
18559625 Observational study of gene-disease association. (HuGE Navigator)
18491255 PDE11A is expressed widely in adrenal cortex. Its expression appears to be increased in PPNAD but varies widely among other adrenocortical tumors.
18312413 N-terminal modifications strongly affect cGMP regulation of hPDE11A4
18043711 Variants in PDE11A are not associated with citalopram response in patient with depression.
17178847 Observational study of genotype prevalence. (HuGE Navigator)
17178847 PDE11A genetic defects may be associated with adrenal pathology in a wider than previously suspected and is associated with adrenal hyperplasia and adenomas.
17008408 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15800651 we detected protein corresponding to PDE11A4, in human prostate, pituitary, heart and liver
11156964 HIV-1 Tat decreases the intracellular levels of cAMP and CREB ser-133 phosphorylation through a signal transduction pathway involving sequential activation of phosphatidylinositol 3-kinase, AKT, and cyclic nucleoside phosphodiesterases

AA Sequence

MAASRLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQGQGALGPRPSLAGTSSLAHSTCRGGS      1 - 70
SVGGGTGPNGSAHSQPLPGGGDCGGVPLSPSWAGGSRGDGNLQRRASQKELRKSFARSKAIHVNRTYDEQ     71 - 140
VTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRVNLPRYPPTAIDYKCHLKKHNERQFFLELVK    141 - 210
DISNDLDLTSLSYKILIFVCLMVDADRCSLFLVEGAAAGKKTLVSKFFDVHAGTPLLPCSSTENSNEVQV    211 - 280
PWGKGIIGYVGEHGETVNIPDAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAP    281 - 350
FTEDDEKVMQMYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC    351 - 420
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVASTGLPVNISD    421 - 490
AYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFEAFVIFCGLGINN    491 - 560
TIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANIPLVSELAIDDIHFDDFSLDVDAMITAALRM    561 - 630
FMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAFNVCQLMFAMLTTAGFQDILTEVEILAVIVG    631 - 700
CLCHDLDHRGTNNAFQAKSGSALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQ    701 - 770
SILATDLTLYFERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE    771 - 840
QGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVATNRSKWEELHQ    841 - 910
KRLLASTASSSPASVMVAKEDRN                                                   911 - 933
//

Text Mined References (46)

PMID Year Title
26820475 2016 A stop-codon of the phosphodiesterase 11A gene is associated with elevated blood pressure and measures of obesity.
26459559 2015 Rare inactivating PDE11A variants associated with testicular germ cell tumors.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
22996146 2012 Phosphodiesterase 11A (PDE11A) gene defects in patients with acth-independent macronodular adrenal hyperplasia (AIMAH): functional variants may contribute to genetic susceptibility of bilateral adrenal tumors.
21697861 Expression and distribution of key enzymes of the cyclic GMP signaling in the human clitoris: relation to phosphodiesterase type 5 (PDE5).
21047926 2011 Frequent phosphodiesterase 11A gene (PDE11A) defects in patients with Carney complex (CNC) caused by PRKAR1A mutations: PDE11A may contribute to adrenal and testicular tumors in CNC as a modifier of the phenotype.
20920776 2010 PDE11A associations with asthma: results of a genome-wide association scan.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20881257 2011 Phosphodiesterase 11A (PDE11A) genetic variants may increase susceptibility to prostatic cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20110084 2010 Failure to replicate genetic associations with antidepressant treatment response in duloxetine-treated patients.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19689430 2009 Binding of cyclic nucleotides to phosphodiesterase 10A and 11A GAF domains does not stimulate catalytic activity.
19671705 2009 Analysis of genetic variants of phosphodiesterase 11A in acromegalic patients.
19557111 2009 Association of PDE11A global haplotype with major depression and antidepressant drug response.
19549888 2009 Functional phosphodiesterase 11A mutations may modify the risk of familial and bilateral testicular germ cell tumors.
19429701 2009 Abnormalities of cAMP signaling are present in adrenocortical lesions associated with ACTH-independent Cushing syndrome despite the absence of mutations in known genes.
19214142 2009 Association study of phosphodiesterase genes in the Sequenced Treatment Alternatives to Relieve Depression sample.
18559625 2008 Phosphodiesterase 11A (PDE11A) and genetic predisposition to adrenocortical tumors.
18491255 2008 Phosphodiesterase 11A expression in the adrenal cortex, primary pigmented nodular adrenocortical disease, and other corticotropin-independent lesions.
18312413 2008 The properties of phosphodiesterase 11A4 GAF domains are regulated by modifications in its N-terminal domain.
18043711 2007 Variants in PDE11A and PDE1A are not associated with citalopram response.
17178847 2006 Adrenal hyperplasia and adenomas are associated with inhibition of phosphodiesterase 11A in carriers of PDE11A sequence variants that are frequent in the population.
17008408 2006 Phosphodiesterase genes are associated with susceptibility to major depression and antidepressant treatment response.
16767104 2006 A genome-wide scan identifies mutations in the gene encoding phosphodiesterase 11A4 (PDE11A) in individuals with adrenocortical hyperplasia.
16330539 2006 cAMP is a ligand for the tandem GAF domain of human phosphodiesterase 10 and cGMP for the tandem GAF domain of phosphodiesterase 11.
16079899 Phosphodiesterase 11 (PDE11): is it a player in human testicular function?
15995148 2005 Expression of PDE11A in normal and malignant human tissues.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15800654 Phosphodiesterase 11 (PDE11) regulation of spermatozoa physiology.
15800651 3',5'-cyclic nucleotide phosphodiesterase 11A: localization in human tissues.
15538396 High biochemical selectivity of tadalafil, sildenafil and vardenafil for human phosphodiesterase 5A1 (PDE5) over PDE11A4 suggests the absence of PDE11A4 cross-reaction in patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11502204 2001 Identification of rat cyclic nucleotide phosphodiesterase 11A (PDE11A): comparison of rat and human PDE11A splicing variants.
11121118 2001 Genomic organization of the human phosphodiesterase PDE11A gene. Evolutionary relatedness with other PDEs containing GAF domains.
11050148 2000 Cloning and characterization of two splice variants of human phosphodiesterase 11A.
10906126 2000 Isolation and characterization of two novel phosphodiesterase PDE11A variants showing unique structure and tissue-specific expression.
10725373 2000 Molecular cloning and characterization of a distinct human phosphodiesterase gene family: PDE11A.
9847074 1998 Toward a complete human genome sequence.
8557689 1996 Isolation and characterization of cDNAs corresponding to two human calcium, calmodulin-regulated, 3',5'-cyclic nucleotide phosphodiesterases.
7935318 1994 Multiple cyclic nucleotide phosphodiesterases.