Property Summary

NCBI Gene PubMed Count 140
PubMed Score 30.40
PubTator Score 154.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.088 5.1e-03
astrocytoma 1.800 2.0e-03
ependymoma 1.300 9.2e-03
oligodendroglioma 1.200 1.5e-02
glioblastoma 1.900 1.6e-03
acute quadriplegic myopathy 1.267 1.1e-08
non-small cell lung cancer -1.140 7.0e-17
intraductal papillary-mucinous neoplasm ... 1.700 3.1e-03
subependymal giant cell astrocytoma 1.188 1.7e-02
Pick disease -1.500 2.7e-05
ulcerative colitis -1.200 2.2e-07
ovarian cancer 2.400 2.5e-06

Gene RIF (146)

PMID Text
26929449 Accordingly, ALIX depletion leads to furrow regression in cells with chromosome bridges, a phenotype associated with abscission checkpoint signaling failure.
26866605 homologous domain of human Bro1 domain-containing proteins, Alix and Brox, binds CHMP4B but not STAM2, despite their high structural similarity
26859355 phosphorylation of the intramolecular interaction site in the PRD is one of the major mechanisms that activates the ESCRT function of ALIX
26490116 We found that ARRDC3 is required for ALIX ubiquitination induced by activation of PAR1
26139244 Our data reveal that AIP1, by inhibiting VEGFR2-dependent signaling in tumor niche, suppresses tumor EMT switch, tumor angiogenesis, and tumor premetastatic niche formation to limit tumor growth and metastasis.
26063962 Findings indicate that the PDCD6IP 15bp insertion/deletion polymorphism decreases the risk of breast neoplasm in an Iranian population.
25749978 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25732677 our findings identify heparanase as a modulator of the syndecan-syntenin-ALIX pathway, fostering endosomal membrane budding and the biogenesis of exosomes by trimming the heparan sulfate chains on syndecans
25710462 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25633977 Knockdown of programmed cell death 6 interacting protein (AIP1, ALIX) by siRNA inhibits HIV-1 release and infectivity
25534348 Lack of ALG-2, ALIX or Vps4B each prevents shedding, and repair of the injured cell membrane
25510652 Alix is critically involved in multivesicular body sorting of membrane receptors in mammalian cells.
25502766 The serum lever of Alzheimer's disease were decrease and the expression of ALIX strongly correlated with the Mini-Mental State Examination scores of the AD patients
25451933 Aip1 has a role in actin filament severing by cofilin and regulates constriction of the cytokinetic contractile ring
25118280 HIV-1 Nef interacts with Alix in late endosomes, and this is required for efficient lysosomal targeting of CD4.
25118280 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25102091 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25099357 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25066606 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
24996823 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
24870593 Results suggest that programmed cell death 6 interacting protein (PDCD6IP) insertion/deletion polymorphism was potentially related to non-small cell lung cancer (NSCLC) susceptibility in Chinese Han population.
24834918 ALIX is recruited to the neck of the assembling HIV-1 virion and is mostly recycled after virion release.
24834918 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
24712823 Alix protein plays a critical role in the maintenance of the barrier function of T84 monolayers
24637612 Syntenin-ALIX exosome biogenesis and budding into multivesicular bodies are controlled by ARF6 and PLD2.
24287454 ALIX regulates these mammalian cell-specific cytokinesis, exosome release, and virus budding. [Review]
24257210 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
23924735 The results of in vitro binding assays using purified recombinant proteins indicated that ALG-2 functions as a Ca(2)-dependent adaptor protein that bridges ALIX and ESCRT-I to form a ternary complex
23895345 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
23777424 Common genetic variations in PDCD6IP may influence hepatocellular carcinoma risk, possibly through promoter activity-mediated regulation.
23664863 Lysobisphosphatidic acid recruits ALIX onto late endosomes via the calcium-bound Bro1 domain, triggering a conformational change in ALIX to mediate the delivery of viral nucleocapsids to the cytosol during infection.
23527201 Alix serves as an adaptor that allows human parainfluenza virus type 1 to interact with the host cell ESCRT system.
23305486 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
23266279 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
23201121 study reports that the V domain of ALIX binds directly and selectively to K63-linked polyubiquitin chains, exhibiting a strong preference for chains composed of more than three ubiquitins
23027949 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
22981647 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
22969426 BFRF1 recruits the ESCRT components to modulate nuclear envelope for the nuclear egress of Epstein Barr virus.
22896625 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
22844345 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
22833563 Data indicate that AP-3 facilitates PAR1 interaction with ALIX.
22771033 At the midbody, BRCA2 influences the recruitment of endosomal sorting complex required for transport (ESCRT)-associated proteins, Alix and Tsg101, and formation of CEP55-Alix and CEP55-Tsg101 complexes during abscission.
22761998 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
22754649 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
22660413 Identify key role for syndecan-syntenin-ALIX in membrane transport and signalling processes.
22641034 Structural recognition mechanisms between human Src homology domain 3 (SH3) and ALG-2-interacting protein X (Alix
22421880 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
22162750 structural analysis of the Bro1 domain protein BROX and functional analyses of the ALIX Bro1 domain in HIV-1 budding
22162750 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
22004035 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
21889351 Mutation of residues within the Phe105 loop of the Bro1 domain compromise Alix function in HIV-1 release.
21889351 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
21762798 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
21762796 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
21738476 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
21715492 Mutations designed to destabilize the closed conformation of the V domain opened the V domain, increased ALIX membrane association, and enhanced HIV-1 budding.
21543492 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
21528537 HIV-1 infection affects the expression of host factors TSG101 and Alix
21248028 The authors demonstrate that ALIX/AIP1, an ESCRT-associated host protein, is required for the incorporation of the nucleoprotein of Mopeia virus, a close relative of Lassa virus, into Z-induced virus-like particles (VLPs).
21129143 Data suggest that the boomerang-shaped Bro1 domain of Alix appears to escort hepatitis B virus naked capsids without ESCRT.
20962096 Crystal structures revealed that anchoring tyrosines and nearby hydrophobic residues contact the ALIX V domain, revealing how SIV gag proteins employ a diverse family of late-domain sequences to bind ALIX and promote virus budding.
20929444 studies on intramolecular interactions:the relieving of specific, autoinhibitory interactions within ALIX regulates binding with ESCRT proteins or viral proteins and is critical for ALIX to participate in retroviral budding
20800603 Observational study of gene-disease association. (HuGE Navigator)
20691033 inability of the two-residue shorter ALG-2 isoform to bind Alix
20670214 Identification and biophysical assessment of the molecular recognition mechanisms between the human haemopoietic cell kinase Src homology domain 3 and ALG-2-interacting protein X
20669987 Examined changes in subcellular proteomes of different cellular compartments of human endothelial cells upon DENV2 infection. Double immunofluorescence staining revealed colocalization of Alix with late endosomal lysobisphosphatidic acid (LBPA).
20605035 The results indicate YLDL motif in M protein is essential for efficient budding in the context of virus infection and suggest involvement of Alix/AIP1 in Sendai virus budding.
20519395 Together these data support a model in which Alix recruits Nedd4-1 to facilitate HIV-1 release mediated through the LYPX(n)L/Alix budding pathway via a mechanism that involves Alix ubiquitination.
20519395 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20156100 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
20018238 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19912576 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19802344 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19706535 Data show that galectin-3 is an inhibitory regulator of T-cell activation and functions intracellularly by promoting TCR down-regulation, possibly through modulating Alix's function at the IS.
19692479 Data suggest that HSV-1 production is independent of ALIX and TSG101 expression.
19639585 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19596386 The authors determined that the p6-Alix interaction plays an important role in HIV-1 replication.
19596386 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19523902 A crescent-shaped Alix dimer targets ESCRT-III CHMB4 filaments.
19520058 Ca2+-loaded ALG-2 bridges Alix and TSG101 as an adaptor protein.
19403673 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19393081 Results identified ALIX as an ubiquitination substrate of POSH and indicate that POSH and ALIX cooperate to facilitate efficient virus release.
19393081 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19282983 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19254034 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19143627 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19099395 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19064259 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19020832 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19016654 The native state of Alix does not have a functional Bro1 domain.
18948538 crystal structure of the ESCRT and ALIX-binding region (EABR) of CEP55 bound to an ALIX peptide at a resolution of 2.0 angstroms; structure shows that EABR forms an aberrant dimeric parallel coiled coil
18940611 A Ca(2+)/EF3-driven arginine switch mechanism for ALG-2 binding to Alix.
18936101 Alix and ALG-2 are new actors of the TNF-R1 pathway
18684393 These results strongly suggest that the capacity of several mutants of Alix to block both caspase-dependent and independent cell death does not relate to their capacity to modulate autophagy.
18644787 Alix down-expression decreases both LBPA levels and the lumenal vesicle content of late endosomes. Cellular cholesterol levels are also decreased, presumably because the storage capacity of endosomes is affected and thus cholesterol clearance accelerated
18641129 the Cep55/Alix/ESCRT-III pathway has a role in cytokinesis and HIV-1 release
18511562 The Bro1 domain of ALIX binds specifically to C-terminal residues of the human CHMP4 proteins (CHMP4A-C).
18477395 C-terminal proline-rich domain of ALIX allows the access of its binding site to p6.
18477395 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
18476810 Study demonstrate that formation or exposure of the p6(Gag)/p9(Gag) docking site in Alix is a regulated event and that Alix association with the membrane may play a positive role in this process.
18476810 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
18380665 ALG-2-interacting protein 1 up-regulates dopamine D1 and D3 receptor expression and is important for their stability and protein trafficking.
18076669 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
18066081 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
18032513 ALIX also binds to the nucleocapsid (NC) domain of HIV-1 Gag and that ALIX and its isolated Bro1 domain can be specifically packaged into viral particles via NC.
18032513 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
18005675 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
17982468 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
17853893 that ALIX and TSG101/ESCRT-I also bind a series of proteins involved in cytokinesis, including CEP55, CD2AP, ROCK1, and IQGAP1.
17673164 These results eliminate the possibility that the two transcript variants encode different isoforms of Alix protein and suggest that alternative polyadenylation is one of the mechanisms controlling Alix protein expression.
17601348 Here, we report that dominant negative forms of Vps4A, Vps4B, and AIP1 inhibit HTLV-1 budding.
17556548 study shows that two proteins involved in HIV-1 budding-Tsg101, a subunit of the endosomal sorting complex required for transport I (ESCRT-I), & Alix, an ESCRT-associated protein-were recruited to the midbody during cytokinesis by interaction with Cep55
17556548 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
17428861 ALIX can have a dramatic effect on HIV-1 release by binding at the CHMP4B site; the ability to use ALIX may allow HIV-1 to replicate in cells that express only low levels of Tsg101
17428861 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
17389591 TNF-induced TRAF2-RIP1-AIP1-ASK1 complex formation and for the activation of ASK1-JNK/p38 apoptotic signaling.
17350572 Crystal structure; ALIX serves as a flexible, extended scaffold that connects retroviral Gag proteins to ESCRT-III and other cellular-budding machinery
17350572 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
17350527 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
17277784 Overexpression of the V domain inhibits HIV-1 release from cells. This inhibition of release is reversed by mutations that block binding of the Alix V domain to p6.
17277784 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
17250865 We also identified a host protein, AlP1/Alix, involved in apoptosis and efficient budding of several enveloped viruses as an interacting partner of the V and NP proteins.
17166905 A YLDL sequence within the M protein showed L-domain activity, and its specific interaction with the N terminus of Alix/AIP1(1-211) was important for the budding of virus-like particles (VLPs) of M protein.
17158451 Alix fragment 364-716 is a potent, Alix binding site-specific inhibitor of HIV-1 assembly and release.
17158451 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
17082185 Alix inhibits down-regulation of PDGFRbeta by modulating the interaction between c-Cbl and the receptor, thereby affecting the ubiquitination of the receptor
17014699 Four proteins (TSG101,Hrs,Aip1/Alix, and Vps4B) of the ESCRT (endosomal sorting complex required for transport) machinery were localized in T cells and macrophages by quantitative electron microscopy.
16764724 The HIV-1 protein Nef contributes to the release of viral particles from infected cells through its interaction with AIP1.
16764724 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
16470130 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
16234236 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
15914539 Alix functions in the actin-dependent intracellular positioning of endosomes
15849434 Partial colocalization of FLAG-tagged Rab GTPase-activating protein-like protein and green fluorescent protein (GFP)-fused Alix was observed at cell edges
15557335 Alix is negatively regulated by Src, via direct interaction and phosphorylation.
15456872 Alix negatively regulates the endocytic complex containing Cbl and SETA/CIN85, and thereby antagonizes receptor endocytosis.
15195070 results suggest that insulin-like growth factor I receptor-induced paraptosis is mediated by MAPKs, and inhibited by AIP-1/Alix
14999017 The region corresponding to amino acid residues 794 to 827 in the carboxy-terminal proline-rich region of Alix is sufficient to confer the ability to interact directly with ALG2. This region includes four-tandem PxY repeats.
14739459 role in control of the formation of multivesicular liposomes induced by lysobisphosphatidic acid (LBPA); regulated the organization of LBPA-containing endosomes in vivo
14519844 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
14505570 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
14505569 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
12860994 CHMP4b and Alix participate in formation of multivesicular bodies by cooperating with SKD1
12771190 adaptor protein SETA (CIN85) and its binding partner AIP1 are involved with the cytoskeleton and in the regulation of cell adhesion
12588984 AIP1/Alix interacts with the apoptosis-linked protein ALG-2 and recognizes recognize the protein-protein binding motif YPXL/I, where Tyr, Pro, and Leu/Ile are crucial for its interactive properties
12360406 p95 has roles in regulating cell adhesion and morphology.

AA Sequence

MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLR      1 - 70
YYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNL     71 - 140
DNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKD    141 - 210
AIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHA    211 - 280
AELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQK    281 - 350
FTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTK    351 - 420
SRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRA    421 - 490
EGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLD    491 - 560
EVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQ    561 - 630
VSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKT    631 - 700
ERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPS    701 - 770
ATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQS    771 - 840
PGQAPYPGPQQPSYPFPQPPQQSYYPQQ                                              841 - 868
//

Text Mined References (155)

PMID Year Title
26929449 2016 ALIX and ESCRT-I/II function as parallel ESCRT-III recruiters in cytokinetic abscission.
26866605 2016 Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0.
26859355 2016 Phosphorylation-Dependent Activation of the ESCRT Function of ALIX in Cytokinetic Abscission and Retroviral Budding.
26490116 2015 The ?-arrestin ARRDC3 mediates ALIX ubiquitination and G protein-coupled receptor lysosomal sorting.
26139244 2015 AIP1 Expression in Tumor Niche Suppresses Tumor Progression and Metastasis.
26063962 2015 Association between Programmed Cell Death 6 Interacting Protein Insertion/Deletion Polymorphism and the Risk of Breast Cancer in a Sample of Iranian Population.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25732677 2015 Heparanase activates the syndecan-syntenin-ALIX exosome pathway.
25534348 2014 Mechanism of Ca²?-triggered ESCRT assembly and regulation of cell membrane repair.
25510652 2015 Unravelling the pivotal role of Alix in MVB sorting and silencing of the activated EGFR.
25502766 2015 Translational study of Alzheimer's disease (AD) biomarkers from brain tissues in A?PP/PS1 mice and serum of AD patients.
25451933 2015 Aip1 promotes actin filament severing by cofilin and regulates constriction of the cytokinetic contractile ring.
25416956 2014 A proteome-scale map of the human interactome network.
25118280 2014 Interaction of HIV-1 Nef protein with the host protein Alix promotes lysosomal targeting of CD4 receptor.
24870593 2014 The programmed cell death 6 interacting protein insertion/deletion polymorphism is associated with non-small cell lung cancer risk in a Chinese Han population.
24834918 2014 ALIX is recruited temporarily into HIV-1 budding sites at the end of gag assembly.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24712823 2014 Staphylococcal enterotoxin B suppresses Alix and compromises intestinal epithelial barrier functions.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24637612 2014 Syntenin-ALIX exosome biogenesis and budding into multivesicular bodies are controlled by ARF6 and PLD2.
24287454 2014 ALIX and the multivesicular endosome: ALIX in Wonderland.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24107264 2013 ESCRT requirements for EIAV budding.
24105262 2013 Analysis of ESCRT functions in exosome biogenesis, composition and secretion highlights the heterogeneity of extracellular vesicles.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23924735 2013 VPS37 isoforms differentially modulate the ternary complex formation of ALIX, ALG-2, and ESCRT-I.
23777424 2013 A functional insertion/deletion polymorphism in the promoter of PDCD6IP is associated with the susceptibility of hepatocellular carcinoma in a Chinese population.
23664863 2013 Viral infection controlled by a calcium-dependent lipid-binding module in ALIX.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23527201 2013 Alix serves as an adaptor that allows human parainfluenza virus type 1 to interact with the host cell ESCRT system.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23201121 2012 ALIX is a Lys63-specific polyubiquitin binding protein that functions in retrovirus budding.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23092844 2013 Monitoring the Rab27 associated exosome pathway using nanoparticle tracking analysis.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22969426 2012 The ESCRT machinery is recruited by the viral BFRF1 protein to the nucleus-associated membrane for the maturation of Epstein-Barr Virus.
22833563 2012 AP-3 regulates PAR1 ubiquitin-independent MVB/lysosomal sorting via an ALIX-mediated pathway.
22771033 2012 BRCA2 localization to the midbody by filamin A regulates cep55 signaling and completion of cytokinesis.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22641034 2012 Structural recognition mechanisms between human Src homology domain 3 (SH3) and ALG-2-interacting protein X (Alix).
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22547407 2012 ALIX binds a YPX(3)L motif of the GPCR PAR1 and mediates ubiquitin-independent ESCRT-III/MVB sorting.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22162750 2011 Structure of the Bro1 domain protein BROX and functional analyses of the ALIX Bro1 domain in HIV-1 budding.
22073189 2011 Exome-sequencing confirms DNAJC5 mutations as cause of adult neuronal ceroid-lipofuscinosis.
21911577 2011 A physical interaction network of dengue virus and human proteins.
21889351 2011 The Phe105 loop of Alix Bro1 domain plays a key role in HIV-1 release.
21786200 2011 Structure and function of ALG-2, a penta-EF-hand calcium-dependent adaptor protein.
21715492 2011 Activation of the retroviral budding factor ALIX.
21528537 2011 [HIV-1 infection affects the expression of host cell factor TSG101 and Alix].
21518163 2011 Proline-rich regions and motifs in trafficking: from ESCRT interaction to viral exploitation.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21394083 2011 Dynamics of ESCRT protein recruitment during retroviral assembly.
21276792 2011 Morphologic and proteomic characterization of exosomes released by cultured extravillous trophoblast cells.
21269460 2011 Initial characterization of the human central proteome.
21248028 2011 ALIX/AIP1 is required for NP incorporation into Mopeia virus Z-induced virus-like particles.
21129143 2011 Alix regulates egress of hepatitis B virus naked capsid particles in an ESCRT-independent manner.
20962096 2011 Identification and structural characterization of the ALIX-binding late domains of simian immunodeficiency virus SIVmac239 and SIVagmTan-1.
20929444 2010 Decoding the intrinsic mechanism that prohibits ALIX interaction with ESCRT and viral proteins.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20691033 2010 Molecular basis for defect in Alix-binding by alternatively spliced isoform of ALG-2 (ALG-2DeltaGF122) and structural roles of F122 in target recognition.
20670214 2010 Identification and biophysical assessment of the molecular recognition mechanisms between the human haemopoietic cell kinase Src homology domain 3 and ALG-2-interacting protein X.
20669987 2010 Association of Alix with late endosomal lysobisphosphatidic acid is important for dengue virus infection in human endothelial cells.
20653365 2010 The ESCRT complexes.
20616062 2010 Human ESCRT-III and VPS4 proteins are required for centrosome and spindle maintenance.
20605035 2010 Significance of the YLDL motif in the M protein and Alix/AIP1 for Sendai virus budding in the context of virus infection.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
20519395 2010 The ESCRT-associated protein Alix recruits the ubiquitin ligase Nedd4-1 to facilitate HIV-1 release through the LYPXnL L domain motif.
20494825 2010 Mutation of tyrosine residue 857 in the PDGF beta-receptor affects cell proliferation but not migration.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20176808 2010 TEX14 interacts with CEP55 to block cell abscission.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19906316 2009 Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site.
19706535 2009 Galectin-3 negatively regulates TCR-mediated CD4+ T-cell activation at the immunological synapse.
19692479 2009 Herpes simplex virus type 1 production requires a functional ESCRT-III complex but is independent of TSG101 and ALIX expression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19596386 2009 Functional role of Alix in HIV-1 replication.
19523902 2009 A crescent-shaped ALIX dimer targets ESCRT-III CHMP4 filaments.
19520058 2009 Penta-EF-hand protein ALG-2 functions as a Ca2+-dependent adaptor that bridges Alix and TSG101.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19393081 2009 Exploring the functional interaction between POSH and ALIX and the relevance to HIV-1 release.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19143631 2009 Alix and ALG-2 make a link between endosomes and neuronal death.
19143629 2009 The mechanism of Ca2+-dependent recognition of Alix by ALG-2: insights from X-ray crystal structures.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19016654 2009 The CHMP4b- and Src-docking sites in the Bro1 domain are autoinhibited in the native state of Alix.
18948538 2008 Midbody targeting of the ESCRT machinery by a noncanonical coiled coil in CEP55.
18940611 2008 Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism.
18936101 2008 Alix and ALG-2 are involved in tumor necrosis factor receptor 1-induced cell death.
18684393 2008 Alix differs from ESCRT proteins in the control of autophagy.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18644787 2008 Lysobisphosphatidic acid controls endosomal cholesterol levels.
18641129 2008 Differential requirements for Alix and ESCRT-III in cytokinesis and HIV-1 release.
18511562 2008 ALIX-CHMP4 interactions in the human ESCRT pathway.
18477395 2008 Refined study of the interaction between HIV-1 p6 late domain and ALIX.
18476810 2008 The HIV-1 p6/EIAV p9 docking site in Alix is autoinhibited as revealed by a conformation-sensitive anti-Alix monoclonal antibody.
18380665 2008 ALG-2 interacting protein AIP1: a novel link between D1 and D3 signalling.
18256029 2008 Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants.
18066081 2008 Structural and functional studies of ALIX interactions with YPX(n)L late domains of HIV-1 and EIAV.
18032513 2008 Human immunodeficiency virus type 1 Gag engages the Bro1 domain of ALIX/AIP1 through the nucleocapsid.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17982468 2007 Beyond Tsg101: the role of Alix in 'ESCRTing' HIV-1.
17853893 2007 Human ESCRT and ALIX proteins interact with proteins of the midbody and function in cytokinesis.
17673164 2007 Alternative polyadenylation produces two major transcripts of Alix.
17601348 2007 Regulation of HTLV-1 Gag budding by Vps4A, Vps4B, and AIP1/Alix.
17556548 2007 Parallels between cytokinesis and retroviral budding: a role for the ESCRT machinery.
17428861 2007 Potent rescue of human immunodeficiency virus type 1 late domain mutants by ALIX/AIP1 depends on its CHMP4 binding site.
17389591 2007 RIP1-mediated AIP1 phosphorylation at a 14-3-3-binding site is critical for tumor necrosis factor-induced ASK1-JNK/p38 activation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17350572 2007 Structural and biochemical studies of ALIX/AIP1 and its role in retrovirus budding.
17277784 2007 Structural basis for viral late-domain binding to Alix.
17250865 2007 The conserved carboxyl terminus of human parainfluenza virus type 2 V protein plays an important role in virus growth.
17196169 2007 ALG-2 directly binds Sec31A and localizes at endoplasmic reticulum exit sites in a Ca2+-dependent manner.
17166905 2007 The YLDL sequence within Sendai virus M protein is critical for budding of virus-like particles and interacts with Alix/AIP1 independently of C protein.
17158451 2007 An Alix fragment potently inhibits HIV-1 budding: characterization of binding to retroviral YPXL late domains.
17082185 2006 Alix facilitates the interaction between c-Cbl and platelet-derived growth factor beta-receptor and thereby modulates receptor down-regulation.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
17014699 2006 Ultrastructural analysis of ESCRT proteins suggests a role for endosome-associated tubular-vesicular membranes in ESCRT function.
16957052 2006 The Ca2+-binding protein ALG-2 is recruited to endoplasmic reticulum exit sites by Sec31A and stabilizes the localization of Sec31A.
16764724 2006 Interactions between Nef and AIP1 proliferate multivesicular bodies and facilitate egress of HIV-1.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16501490 2006 Collection, storage, preservation, and normalization of human urinary exosomes for biomarker discovery.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15914539 2005 Alix regulates cortical actin and the spatial distribution of endosomes.
15908698 2005 Tsg101 and Alix interact with murine leukemia virus Gag and cooperate with Nedd4 ubiquitin ligases during budding.
15849434 2005 Identification of Rab GTPase-activating protein-like protein (RabGAPLP) as a novel Alix/AIP1-interacting protein.
15557335 2005 Src phosphorylation of Alix/AIP1 modulates its interaction with binding partners and antagonizes its activities.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456872 2004 Alix/AIP1 antagonizes epidermal growth factor receptor downregulation by the Cbl-SETA/CIN85 complex.
15326289 2004 Identification and proteomic profiling of exosomes in human urine.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15195070 2004 Paraptosis: mediation by MAP kinases and inhibition by AIP-1/Alix.
14999017 2004 The penta-EF-hand protein ALG-2 interacts with a region containing PxY repeats in Alix/AIP1, which is required for the subcellular punctate distribution of the amino-terminal truncation form of Alix/AIP1.
14739459 2004 Role of LBPA and Alix in multivesicular liposome formation and endosome organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14678797 2004 CHMP4b is a major binding partner of the ALG-2-interacting protein Alix among the three CHMP4 isoforms.
14583093 2004 Structure and function of human Vps20 and Snf7 proteins.
14519844 2003 Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.
14505570 2003 The protein network of HIV budding.
14505569 2003 AIP1/ALIX is a binding partner for HIV-1 p6 and EIAV p9 functioning in virus budding.
12860994 2003 The ALG-2-interacting protein Alix associates with CHMP4b, a human homologue of yeast Snf7 that is involved in multivesicular body sorting.
12771190 2003 SETA/CIN85/Ruk and its binding partner AIP1 associate with diverse cytoskeletal elements, including FAKs, and modulate cell adhesion.
12588984 2003 YPXL/I is a protein interaction motif recognized by aspergillus PalA and its human homologue, AIP1/Alix.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12360406 2002 Hp95 promotes anoikis and inhibits tumorigenicity of HeLa cells.
12034747 2002 Alix (ALG-2-interacting protein X), a protein involved in apoptosis, binds to endophilins and induces cytoplasmic vacuolization.
11883939 2002 ALG-2 interacts with the amino-terminal domain of annexin XI in a Ca(2+)-dependent manner.
11683497 2001 Overexpression of Hp95 induces G1 phase arrest in confluent HeLa cells.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
10200558 1999 Alix, a novel mouse protein undergoing calcium-dependent interaction with the apoptosis-linked-gene 2 (ALG-2) protein.
9880530 1999 Cloning of AIP1, a novel protein that associates with the apoptosis-linked gene ALG-2 in a Ca2+-dependent reaction.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.