Property Summary

NCBI Gene PubMed Count 60
PubMed Score 56.51
PubTator Score 36.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Pick disease 1893 4.7e-06
ovarian cancer 8491 1.2e-04
non primary Sjogren syndrome sicca 840 2.1e-02
Disease Target Count Z-score Confidence
Ovarian cystadenoma 5 3.345 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 2.1e-02
Pick disease -1.200 4.7e-06
ovarian cancer 1.900 1.2e-04

Gene RIF (29)

PMID Text
25362542 Our results suggest that PDCD6 may play an important role in the pathogenesis of cervical squamous cell carcinoma
24792888 PDCD6 may represent a biomarker candidate gene that could help to identify a group of patients at high risk for recurrence and death.
24078636 CHERP and ALG-2 participate in regulation of alternative splicing of IP3R1 pre-mRNA and provide new insights into post-transcriptional regulation of splicing variants in Ca(2+) signaling pathways.
23649269 the binding of ALG-2 to IST1 is Ca(2+)-dependent
23551056 The present study provided evidence that rs4957014 and rs3756712 are associated with Uterine leiomyoma (UL) risk, the results indicated that genetic polymorphisms in PDCD6 may contribute to the development of UL.
23350699 Palmitoylation sites and the N-terminal Pro-rich region were necessary for efficient secretion, but ABSs (ALG-2-binding sites) were dispensable.
23167403 The results of this study show that rs4957014G/T is associated with an increased risk of non-small cell lung cancer (NSCLC), which suggest that PDCD6 gene single nucleotide polymorphism is a risk factor for susceptibility of NSCLC.
23137875 the current study indicates that PDCD6 gene may be a new susceptibility gene to endometriosis.
22712728 we conclude that a novel p53-responsive gene PDCD6 is accumulated in the nucleus and induces apoptosis in response to DNA damage.
22369209 PDCD6 seems to play an important role in ovarian cancer progression.
22161137 PDCD6 may have a role in advanced gastric cancer
22142513 PDCD6 exerts its anti-tumor potency by activating the p53-p21 protein for G1 phase of cell cycle progression and apoptosis
21893193 programmed cell death 6 protein plays a significant role in modulating cellular angiogenesis
19864416 ALG-2 acts as a Ca(2+) sensor that modulates the function of MCOLN1 along the late endosomal-lysosomal pathway.
18997320 Results describe the crystallization and structural analysis of N-terminally truncated human ALG-2.
18957060 lower mRNA expression levels of PDCD6 were correlated significantly with a poor overall survival in gastric cancer.
18940611 A Ca(2+)/EF3-driven arginine switch mechanism for ALG-2 binding to Alix.
18256029 Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants
17196169 These findings establish Sec31A as a novel target for ALG-2 and provide a framework for studies on the roles of ALG-2 in ER-Golgi transport.
17045351 ALG-2 alone evenly distributed within the cell, whereas in the presence of RBM22 the two proteins co-localized within the nucleus.
16957052 ALG-2 is recruited to endoplasmic reticulum exit sites via Ca(2+)-dependent interaction with Sec31A and in turn stabilizes the localization of Sec31A at these sites.
15925322 Raf-1 may mediate its anti-apoptotic function by interrupting ASK1-dependent phosphorylation of ALG-2.
15366927 The down-regulation of ALG-2 in human uveal melanoma cells compared to their progenitor cells, normal melanocytes, may provide melanoma cells with a selective advantage by interfering with Ca+-mediated apoptotic signals, thereby enhancing cell survival.
12819013 Data show that ALG-2 is overexpressed in liver and lung neoplasms, and is mainly found in epithelial cells in the lung.
12445461 ALG-2 has roles in both cell proliferation and cell death.
12445460 The penta-EF-hand domain of ALG-2 interacts with amino-terminal domains of both annexin VII and annexin XI in a Ca2+-dependent manner.
11883939 Pro/Gly/Tyr/Ala-rich hydrophobic region in Anexin XI masked the Ca(2+)-dependently exposed hydrophobic surface of ALG-2.
11883899 ALG-2 is stabilized by dimerization through its fifth EF-hand region
11606059 Apoptosis-linked gene 2 binds to the death domain of Fas and dissociates from Fas during Fas-mediated apoptosis in Jurkat cells.

AA Sequence

MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIIS      1 - 70
MFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDR     71 - 140
QGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV                       141 - 191
//

Text Mined References (67)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25362542 2015 Single nucleotide polymorphisms in PDCD6 gene are associated with the development of cervical squamous cell carcinoma.
24792888 2014 Prognostic value of PDCD6 polymorphisms and the susceptibility to bladder cancer.
24078636 2013 Nuclear ALG-2 protein interacts with Ca2+ homeostasis endoplasmic reticulum protein (CHERP) Ca2+-dependently and participates in regulation of alternative splicing of inositol trisphosphate receptor type 1 (IP3R1) pre-mRNA.
23924735 2013 VPS37 isoforms differentially modulate the ternary complex formation of ALIX, ALG-2, and ESCRT-I.
23649269 2013 Mammalian ESCRT-III-related protein IST1 has a distinctive met-pro repeat sequence that is essential for interaction with ALG-2 in the presence of Ca2+.
23551056 2013 Variations in the PDCD6 gene are associated with increased uterine leiomyoma risk in the Chinese.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23350699 2013 ALG-2-interacting Tubby-like protein superfamily member PLSCR3 is secreted by an exosomal pathway and taken up by recipient cultured cells.
23167403 2012 Genetic variation in PDCD6 and susceptibility to lung cancer.
23137875 2013 Association between two single nucleotide polymorphisms of PDCD6 gene and increased endometriosis risk.
22712728 2012 Programmed cell death 6, a novel p53-responsive gene, targets to the nucleus in the apoptotic response to DNA damage.
22369209 2012 PDCD6 is an independent predictor of progression free survival in epithelial ovarian cancer.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22161137 2012 Programmed cell death 6 (PDCD6) as a prognostic marker for gastric cancers.
22142513 2012 PDCD6 additively cooperates with anti-cancer drugs through activation of NF-?B pathways.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21893193 2012 Programmed cell death 6 (PDCD6) inhibits angiogenesis through PI3K/mTOR/p70S6K pathway by interacting of VEGFR-2.
21269460 2011 Initial characterization of the human central proteome.
21122810 2011 Stress induced subcellular distribution of ALG-2, RBM22 and hSlu7.
20691033 2010 Molecular basis for defect in Alix-binding by alternatively spliced isoform of ALG-2 (ALG-2DeltaGF122) and structural roles of F122 in target recognition.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19864416 2009 Identification of the penta-EF-hand protein ALG-2 as a Ca2+-dependent interactor of mucolipin-1.
19520058 2009 Penta-EF-hand protein ALG-2 functions as a Ca2+-dependent adaptor that bridges Alix and TSG101.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18997320 2008 Crystallization and X-ray diffraction analysis of N-terminally truncated human ALG-2.
18957060 2008 Identification of prognostic biomarkers in gastric cancer using endoscopic biopsy samples.
18940611 2008 Structural basis for Ca2+ -dependent formation of ALG-2/Alix peptide complex: Ca2+/EF3-driven arginine switch mechanism.
18256029 2008 Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants.
17889823 2007 The calcium binding protein ALG-2 binds and stabilizes Scotin, a p53-inducible gene product localized at the endoplasmic reticulum membrane.
17214967 2007 ALG-2 oscillates in subcellular localization, unitemporally with calcium oscillations.
17196169 2007 ALG-2 directly binds Sec31A and localizes at endoplasmic reticulum exit sites in a Ca2+-dependent manner.
17174262 2007 HD-PTP and Alix share some membrane-traffic related proteins that interact with their Bro1 domains or proline-rich regions.
17045351 2006 Nuclear translocation of the calcium-binding protein ALG-2 induced by the RNA-binding protein RBM22.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16957052 2006 The Ca2+-binding protein ALG-2 is recruited to endoplasmic reticulum exit sites by Sec31A and stabilizes the localization of Sec31A.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16132846 2005 Programmed cell death 6 (PDCD6) protein interacts with death-associated protein kinase 1 (DAPk1): additive effect on apoptosis via caspase-3 dependent pathway.
16004603 2005 The penta-EF-hand protein ALG-2 interacts directly with the ESCRT-I component TSG101, and Ca2+-dependently co-localizes to aberrant endosomes with dominant-negative AAA ATPase SKD1/Vps4B.
15925322 2005 Apoptosis-linked gene-2 connects the Raf-1 and ASK1 signalings.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15366927 2004 Ca2+ binding to EF hands 1 and 3 is essential for the interaction of apoptosis-linked gene-2 with Alix/AIP1 in ocular melanoma.
14999017 2004 The penta-EF-hand protein ALG-2 interacts with a region containing PxY repeats in Alix/AIP1, which is required for the subcellular punctate distribution of the amino-terminal truncation form of Alix/AIP1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12819013 2003 Up-regulation of ALG-2 in hepatomas and lung cancer tissue.
12804766 2003 The PEF family proteins sorcin and grancalcin interact in vivo and in vitro.
12522145 2003 Identification of targets for calcium signaling through the copine family of proteins. Characterization of a coiled-coil copine-binding motif.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445461 2002 ALG-2: a Ca2+ -binding modulator protein involved in cell proliferation and in cell death.
12445460 2002 The penta-EF-hand domain of ALG-2 interacts with amino-terminal domains of both annexin VII and annexin XI in a Ca2+-dependent manner.
12372597 2002 Interaction of ALG-2 with ASK1 influences ASK1 localization and subsequent JNK activation.
12034747 2002 Alix (ALG-2-interacting protein X), a protein involved in apoptosis, binds to endophilins and induces cytoplasmic vacuolization.
11883939 2002 ALG-2 interacts with the amino-terminal domain of annexin XI in a Ca(2+)-dependent manner.
11883899 2002 Both ALG-2 and peflin, penta-EF-hand (PEF) proteins, are stabilized by dimerization through their fifth EF-hand regions.
11606059 2001 Apoptosis-linked gene 2 binds to the death domain of Fas and dissociates from Fas during Fas-mediated apoptosis in Jurkat cells.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11278427 2001 Peflin and ALG-2, members of the penta-EF-hand protein family, form a heterodimer that dissociates in a Ca2+-dependent manner.
11108958 2000 The ALG-2/AIP-complex, a modulator at the interface between cell proliferation and cell death? A hypothesis.
10858458 2000 The glioma-associated protein SETA interacts with AIP1/Alix and ALG-2 and modulates apoptosis in astrocytes.
10744743 2000 Two forms of the apoptosis-linked protein ALG-2 with different Ca(2+) affinities and target recognition.
9880530 1999 Cloning of AIP1, a novel protein that associates with the apoptosis-linked gene ALG-2 in a Ca2+-dependent reaction.
8560270 1996 Interfering with apoptosis: Ca(2+)-binding protein ALG-2 and Alzheimer's disease gene ALG-3.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.