Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.19
PubTator Score 0.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma 1.223 4.2e-05
intraductal papillary-mucinous neoplasm ... 1.200 2.5e-03
osteosarcoma -2.462 9.3e-06
Pick disease -1.500 1.2e-04
psoriasis -1.400 1.6e-04

Gene RIF (1)

AA Sequence

MARAAPLLAALTALLAAAAAGGDAPPGKIAVVGAGIGGSAVAHFLQQHFGPRVQIDVYEKGTVGGRLATI      1 - 70
SVNKQHYESGAASFHSLSLHMQDFVKLLGLRHRREVVGRSAIFGGEHFMLEETDWYLLNLFRLWWHYGIS     71 - 140
FLRLQMWVEEVMEKFMRIYKYQAHGYAFSGVEELLYSLGESTFVNMTQHSVAESLLQVGVTQRFIDDVVS    141 - 210
AVLRASYGQSAAMPAFAGAMSLAGAQGSLWSVEGGNKLVCSGLLKLTKANVIHATVTSVTLHSTEGKALY    211 - 280
QVAYENEVGNSSDFYDIVVIATPLHLDNSSSNLTFAGFHPPIDDVQGSFQPTVVSLVHGYLNSSYFGFPD    281 - 350
PKLFPFANILTTDFPSFFCTLDNICPVNISASFRRKQPQEAAVWRVQSPKPLFRTQLKTLFRSYYSVQTA    351 - 420
EWQAHPLYGSRPTLPRFALHDQLFYLNALEWAASSVEVMAVAAKNVALLAYNRWYQDLDKIDQKDLMHKV    421 - 490
KTEL                                                                      491 - 494
//

Text Mined References (11)

PMID Year Title