Tbio Phosphatidylcholine transfer protein

Add to cart

View Collections

Empty Collection

Catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule.

Property Summary

NCBI Gene PubMed Count	17
PubMed Score	56.29

PubTator Score	19.14

Knowledge Summary

Patent

No data available

TINX Plot

Disease (1)

Expression Atlas

Disease	Target Count	P-value
astrocytoma	1146	2.2e-16
lung adenocarcinoma	2716	4.3e-07
lung cancer	4740	5.9e-05
psoriasis	6694	8.2e-05
ovarian cancer	8520	2.3e-04
pancreatic ductal adenocarcinoma liver metastasis	1962	2.0e-03

Differential Expression (6)

Disease	log2 FC	p
astrocytoma	1.100	2.2e-16
lung adenocarcinoma	-1.100	4.3e-07
lung cancer	-2.200	5.9e-05
ovarian cancer	1.700	2.3e-04
pancreatic ductal adenocarcinoma liver m...	-2.310	2.0e-03
psoriasis	-1.200	8.2e-05

Liver 18,071

Nerve - Tibial 18,007

Testis 18,518

Spleen 17,614

Adipose - Visceral (Omentum) 17,937

Cells - EBV-transformed lymphocytes 18,186

Colon - Sigmoid 18,089

Lung 18,057

Stomach 17,879

Small Intestine - Terminal Ileum 17,954

Ovary 17,971

Vagina 17,834

Uterus 17,618

Cells - Transformed fibroblasts 17,577

Adipose - Subcutaneous 18,110

Esophagus - Gastroesophageal Junction 18,000

Prostate 18,213

Breast - Mammary Tissue 18,103

Colon - Transverse 17,825

Thyroid 18,024

Kidney - Cortex 17,329

Artery - Coronary 17,949

Esophagus - Muscularis 18,017

Esophagus - Mucosa 18,076

Pituitary 18,147

Minor Salivary Gland 18,005

Adrenal Gland 18,071

Muscle - Skeletal 17,778

Whole Blood 17,439

Heart - Atrial Appendage 17,896

Skin - Sun Exposed (Lower leg) 17,968

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Substantia nigra 17,981

Artery - Tibial 17,631

Skin - Not Sun Exposed (Suprapubic) 18,081

Artery - Aorta 17,896

Heart - Left Ventricle 18,006

Brain - Hypothalamus 18,169

Brain - Cerebellum 17,983

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Cerebellar Hemisphere 18,015

Brain - Cortex 18,039

Brain - Amygdala 18,006

Brain - Caudate (basal ganglia) 18,001

Brain - Spinal cord (cervical c-1) 17,973

Brain - Frontal Cortex (BA9) 18,069

Pancreas 18,123

Brain - Putamen (basal ganglia) 17,863

Brain - Hippocampus 18,011

Adult Liver 9,113

NK Cells 8,475

Adult Kidney 6,723

Platelets 6,131

Fetal Liver 8,402

Monocytes 7,422

Adult Ovary 10,192

Adult Testis 10,836

CD4 Cells 7,773

Fetal Gut 8,640

CD8 Cells 9,840

Adult Pancreas 9,168

Adult Rectum 8,022

Adult Prostate 8,952

Adult Lung 6,663

Adult Heart 6,506

Fetal Heart 9,228

B Cells 9,086

Adult Urinary Bladder 7,592

Fetal Testis 7,955

Adult Gallbladder 7,612

Blood platelet

Gall bladder

Gut

Heart

Kidney

Liver

Lung

B-lymphocyte

Monocyte

Natural killer cell

Ovary

Pancreas

Placenta 6,083

Prostate gland

Rectum

Testis

Urinary bladder

BTO:0004410

BTO:0005453

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Erythroleukemia cell 4,300

Kidney 1,299

Liver 5,008

Uterus 1,493

B-lymphocyte cell line 272

See source...

Hepatic cecum 8

See source...

Synonym

Accession	Q9UKL6 Q9BSC9 Q9UIT3 Q9UKW7 PC-TP
Symbols	PC-TP STARD2

Gene

PCTP

Ortholog (11)

Species	Source	Disease
Macaque 12,758	Inparanoid OMA
Chimp 14,136	OMA EggNOG
Rat 15,112	Inparanoid OMA
Mouse 16,567	Inparanoid OMA
Cow 15,316	Inparanoid OMA
Dog 15,069	Inparanoid OMA EggNOG
Opossum 12,223	Inparanoid OMA EggNOG
Pig 10,164	Inparanoid OMA
Anole lizard 10,585	Inparanoid OMA EggNOG
Chicken 7,823	Inparanoid OMA
Zebrafish 9,725	Inparanoid OMA

UniProt Keyword (11)

Complete proteome 20,231

Polymorphism 12,194

Reference proteome 20,231

Alternative splicing 10,528

Cytoplasm 4,952

Phosphoprotein 8,216

Acetylation 3,409

3D-structure 6,226

Transport 1,985

Lipid-binding 224

See all...

GO Function (2)

phosphatidylcholine binding 21

phosphatidylcholine transporter activity 5

GO Component (1)

cytosol 4,834

GO Process (3)

lipid transport 46

phosphatidylcholine biosynthetic process 33

phospholipid transport 20

Compartment GO Term (10)

Cell 16,178

Cell part 16,177

Cytoplasm 10,983

Cytoplasmic part 9,247

Cytosol 6,686

Intracellular 14,108

Intracellular part 13,972

Nucleoli 942

Nucleus 7,562

cellular_component 18,320

MGI Phenotype (6)

homeostasis-metabolism phenotype 4,747

cellular phenotype 3,637

hematopoietic system phenotype 3,383

liver-biliary system phenotype 1,300

immune system phenotype 3,461

normal phenotype 1,999

GWAS Trait (1)

IgG glycosylation 250

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

Pathway (7)

Fatty acid metabolism 180

Metabolism 2,081

Metabolism of lipids 739

Phospholipid metabolism 209

Glycerophospholipid biosynthesis 127

Mitochondrial Fatty Acid Beta-Oxidation 37

Synthesis of PC 27

Protein-protein Interaction (1)

VAPA

PDB (3)

...
More...

Gene RIF (11)

AA Sequence

MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLAD      1 - 70
IYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSM     71 - 140
PQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNY    141 - 210
LKKT                                                                      211 - 214
//

Text Mined References (21)

Summary
Details

	PMID	Year	Title

Tbio Phosphatidylcholine transfer protein Add to cart View Collections Empty Collection