Property Summary

NCBI Gene PubMed Count 37
PubMed Score 172.30
PubTator Score 107.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Cardiovascular Diseases 50
Disease Target Count P-value
ovarian cancer 8491 2.9e-06
psoriasis 6685 5.8e-05
oligodendroglioma 2849 3.8e-03
ependymoma 2514 3.8e-03
interstitial cystitis 2299 4.9e-03
osteosarcoma 7933 8.1e-03
non-inflammatory breast cancer 208 2.4e-02
Disease Target Count Z-score Confidence
Iron metabolism disease 17 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.123 1.6
Plantar fasciitis 5 3.12 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.300 3.8e-03
oligodendroglioma 1.500 3.8e-03
psoriasis 1.700 5.8e-05
osteosarcoma -1.231 8.1e-03
interstitial cystitis 1.200 4.9e-03
non-inflammatory breast cancer -1.300 2.4e-02
ovarian cancer -1.200 2.9e-06

Gene RIF (20)

PMID Text
25504030 The data suggest that PCSK7 genotypes may interact with dietary CHO intake on changes in insulin sensitivity in the white Americans.
24556216 Results demonstrate that PCSK7 variation is a strong host risk factor of liver cirrhosis in hereditary hemochromatosis patients homozygous for HFE C282Y.
24436242 Furin and PC7 siRNAs induced HIF-1alpha protein by increasing its translation, resulting in upregulation of VEGF-A.
23686857 overexpression of PCs, furin and PC5, but not PC7, which are all expressed in SMC, increase PKGI cleavage in a dose-dependent manner
23390091 Among the PC family members, only furin activates hepcidin in hepatocytes, and uniquely the full-length membrane-bound PC7 can directly shed hTfR1 by cleavage at Arg100
22294700 Region encoded by amino acids ala713-asp730 is essential and sufficient for endocytosis.
21209099 Proprotein convertase PC7 enhances the activation of the EGF receptor pathway through processing of the EGF precursor.
21149283 PCSK7 is involved in sTfR generation and iron homeostasis.
21075846 PC7 is distinct from other proprotein convertases in its zymogen activation, subcellular localization, and trafficking.
20164418 Mass spectrometry analysis provides evidence that the HLA-B51-presented peptide profile is altered in the absence of peptide-loading complex quality control or lack of PC7 function in major histocompatibility (MHC) class I-mediated antigen presentation.
17242158 in binding VEGFR-2, furin and PC5 promote cleavage of N-and C-terminal VEGF-D propeptides, whereas PC7 promotes cleavage of the C-terminal propeptide only
12354117 Kexin/subtilisin-related convertases such as furin, PACE4, PC1, PC2, PC7/LPC, PC5, and its isoform PC5/6-B can process HIV-1 gp160 to gp120/gp41
12071862 Kexin/subtilisin-related convertases such as furin, PACE4, PC1, PC2, PC7/LPC, PC5, and its isoform PC5/6-B can process HIV-1 gp160 to gp120/gp41
11723118 we investigated the specificity and potency of complete prodomains and short C-terminal prodomain peptides of each SPC on highly purified, soluble enzyme preparations of human SPC1, SPC6, and SPC7.
11063880 Kexin/subtilisin-related convertases such as furin, PACE4, PC1, PC2, PC7/LPC, PC5, and its isoform PC5/6-B can process HIV-1 gp160 to gp120/gp41
10452538 Kexin/subtilisin-related convertases such as furin, PACE4, PC1, PC2, PC7/LPC, PC5, and its isoform PC5/6-B can process HIV-1 gp160 to gp120/gp41
9521771 Kexin/subtilisin-related convertases such as furin, PACE4, PC1, PC2, PC7/LPC, PC5, and its isoform PC5/6-B can process HIV-1 gp160 to gp120/gp41
9094426 Kexin/subtilisin-related convertases such as furin, PACE4, PC1, PC2, PC7/LPC, PC5, and its isoform PC5/6-B can process HIV-1 gp160 to gp120/gp41
8995623 Kexin/subtilisin-related convertases such as furin, PACE4, PC1, PC2, PC7/LPC, PC5, and its isoform PC5/6-B can process HIV-1 gp160 to gp120/gp41
8940009 Kexin/subtilisin-related convertases such as furin, PACE4, PC1, PC2, PC7/LPC, PC5, and its isoform PC5/6-B can process HIV-1 gp160 to gp120/gp41

AA Sequence

MPKGRQKVPHLDAPLGLPTCLWLELAGLFLLVPWVMGLAGTGGPDGQGTGGPSWAVHLESLEGDGEEETL      1 - 70
EQQADALAQAAGLVNAGRIGELQGHYLFVQPAGHRPALEVEAIRQQVEAVLAGHEAVRWHSEQRLLRRAK     71 - 140
RSVHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRGVTVVVVDDGVEHTIQDIAPNYSPEGSYDLN    141 - 210
SNDPDPMPHPDVENGNHHGTRCAGEIAAVPNNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQI    211 - 280
NDIYSCSWGPDDDGKTVDGPHQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVT    281 - 350
IGAVDEEGRMPFYAEECASMLAVTFSGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALML    351 - 420
QVRPCLTWRDVQHIIVFTATRYEDRRAEWVTNEAGFSHSHQHGFGLLNAWRLVNAAKIWTSVPYLASYVS    421 - 490
PVLKENKAIPQSPRSLEVLWNVSRMDLEMSGLKTLEHVAVTVSITHPRRGSLELKLFCPSGMMSLIGAPR    491 - 560
SMDSDPNGFNDWTFSTVRCWGERARGTYRLVIRDVGDESFQVGILRQWQLTLYGSVWSAVDIRDRQRLLE    561 - 630
SAMSGKYLHDDFALPCPPGLKIPEEDGYTITPNTLKTLVLVGCFTVFWTVYYMLEVYLSQRNVASNQVCR    631 - 700
SGPCHWPHRSRKAKEEGTELESVPLCSSKDPDEVETESRGPPTTSDLLAPDLLEQGDWSLSQNKSALDCP    701 - 770
HQHLDVPHGKEEQIC                                                           771 - 785
//

Text Mined References (38)

PMID Year Title
25504030 2015 PCSK7 genotype modifies effect of a weight-loss diet on 2-year changes of insulin resistance: the POUNDS LOST trial.
24556216 2014 Evaluation of genome-wide loci of iron metabolism in hereditary hemochromatosis identifies PCSK7 as a host risk factor of liver cirrhosis.
24436242 2015 Regulation of HIF-1 alpha by the proprotein convertases furin and PC7 in human squamous carcinoma cells.
23775089 2013 The multifaceted proprotein convertases: their unique, redundant, complementary, and opposite functions.
23686857 2013 Proprotein convertases play an important role in regulating PKGI endoproteolytic cleavage and nuclear transport.
23390091 2013 Implication of the proprotein convertases in iron homeostasis: proprotein convertase 7 sheds human transferrin receptor 1 and furin activates hepcidin.
22679642 2012 The biology and therapeutic targeting of the proprotein convertases.
22294700 2012 Internalization of proprotein convertase PC7 from plasma membrane is mediated by a novel motif.
21805237 2011 The proprotein convertases, 20 years later.
21805236 2011 The prohormone theory and the proprotein convertases: it is all about serendipity.
21209099 2011 Proprotein convertase PC7 enhances the activation of the EGF receptor pathway through processing of the EGF precursor.
21149283 2011 Novel association to the proprotein convertase PCSK7 gene locus revealed by analysing soluble transferrin receptor (sTfR) levels.
21075846 2011 The proprotein convertase PC7: unique zymogen activation and trafficking pathways.
20164418 2010 Post-endoplasmic reticulum rescue of unstable MHC class I requires proprotein convertase PC7.
18343183 2008 The activation and physiological functions of the proprotein convertases.
17242158 2007 Proprotein convertases promote processing of VEGF-D, a critical step for binding the angiogenic receptor VEGFR-2.
15606899 2005 Beta-amyloid protein converting enzyme 1 and brain-specific type II membrane protein BRI3: binding partners processed by furin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12084516 2002 Enzymatic activity of soluble and membrane tethered peptide pro-hormone convertase 1.
11723118 2002 Inhibitory potency and specificity of subtilase-like pro-protein convertase (SPC) prodomains.
11380615 2001 Proprotein convertase expression and localization in epidermis: evidence for multiple roles and substrates.
11104692 2000 Dynamic palmitoylation of lymphoma proprotein convertase prolongs its half-life, but is not essential for trans-Golgi network localization.
11051545 2000 A mechanism for translationally coupled mRNA turnover: interaction between the poly(A) tail and a c-fos RNA coding determinant via a protein complex.
10964928 2000 Binding of BiP to the processing enzyme lymphoma proprotein convertase prevents aggregation, but slows down maturation.
10715106 2000 Inhibitory activity and structural characterization of a C-terminal peptide fragment derived from the prosegment of the proprotein convertase PC7.
10409610 1999 Proteolytic processing in the secretory pathway.
10362256 1999 Molecular analysis of an unstable genomic region at chromosome band 11q23 reveals a disruption of the gene encoding the alpha2 subunit of platelet-activating factor acetylhydrolase (Pafah1a2) in human lymphoma.
10050053 1999 Subtilisin-like proprotein convertases, PACE4 and PC8, as well as furin, are endogenous proalbumin convertases in HepG2 cells.
9820811 1998 Gene organization and alternative splicing of human prohormone convertase PC8.
9341152 1997 Biosynthesis, distinct post-translational modifications, and functional characterization of lymphoma proprotein convertase.
9094426 1997 Comparative functional role of PC7 and furin in the processing of the HIV envelope glycoprotein gp160.
8995623 1997 The role of eukaryotic subtilisin-like endoproteases for the activation of human immunodeficiency virus glycoproteins in natural host cells.
8615762 1996 PC8 [corrected], a new member of the convertase family.
8564950 1996 A new member of the proprotein convertase gene family (LPC) is located at a chromosome translocation breakpoint in lymphomas.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7819324 1994 The family of subtilisin/kexin like pro-protein and pro-hormone convertases: divergent or shared functions.