Property Summary

NCBI Gene PubMed Count 21
PubMed Score 187.98
PubTator Score 23.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.514 3.0e-02
glioblastoma -1.900 4.8e-03
group 3 medulloblastoma -2.900 2.9e-05
lung adenocarcinoma 1.600 4.4e-05
lung carcinoma 1.800 1.9e-27
medulloblastoma, large-cell -2.800 7.2e-04
Multiple Sclerosis 1.900 3.0e-03
nephrosclerosis -1.024 2.2e-02
Pick disease -1.500 7.4e-03
psoriasis -1.900 6.8e-23

Synonym

Accession Q9UHG2 Q4VC04
Symbols PEN
SAAS
SCG8
BigLEN
SgVIII
PROSAAS

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (4)

AA Sequence

MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALCARPVKEPRGLSAASPPLAETGAPRRFRRSVPRGEAAG      1 - 70
AVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARAL     71 - 140
LRARLDPAALAAQLVPAPVPAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSE    141 - 210
GVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP                        211 - 260
//

Text Mined References (24)

PMID Year Title