Property Summary

Ligand Count 6
NCBI Gene PubMed Count 103
PubMed Score 205.53
PubTator Score 630.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
diabetes mellitus 1728 3.318 1.7

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 5.656 3.2e-05
Alzheimer's disease -2.300 2.7e-02
astrocytic glioma -2.900 9.8e-03
atypical teratoid / rhabdoid tumor -3.300 5.6e-04
Down syndrome -1.700 5.2e-03
ependymoma -3.600 1.5e-03
fibroadenoma 1.300 3.2e-05
glioblastoma multiforme -1.500 6.2e-08
group 4 medulloblastoma -3.500 2.8e-03
interstitial cystitis 5.000 2.9e-04
lung cancer 5.400 2.3e-07
lung carcinoma 6.300 9.7e-56
malignant mesothelioma -2.100 4.0e-06
oligodendroglioma -2.400 1.6e-02
pancreatic cancer -1.600 1.2e-02
Parkinson's disease -1.200 3.0e-02
Pick disease -1.900 1.5e-02
psoriasis 2.600 5.0e-52
ulcerative colitis 3.200 1.1e-06

Protein-protein Interaction (5)

Gene RIF (77)

AA Sequence

MERRAWSLQCTAFVLFCAWCALNSAKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQIGSLENHYLF      1 - 70
KHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSALRDSALNLFNDPMWNQQWYLQDTRMTAA     71 - 140
LPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRYDPTNENKHGT    141 - 210
RCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGP    211 - 280
GRLAQKAFEYGVKQGRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSST    281 - 350
LATSYSSGDYTDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL    351 - 420
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALKANGEVIIEIP    421 - 490
TRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERERDTSPNGFKNWDFMSVHTWG    491 - 560
ENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEKMVDPGEEQ    561 - 630
PTQENPKENTLVSKSPSSSSVGGRRDELEEGAPSQAMLRLLQSAFSKNSPPKQSPKKSPSAKLNIPYENF    631 - 700
YEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN                     701 - 753
//

Text Mined References (106)

PMID Year Title