Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.45
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -3.300 2.6e-05
astrocytic glioma -2.700 4.2e-03
Astrocytoma, Pilocytic -3.400 6.6e-11
atypical teratoid / rhabdoid tumor -4.200 8.6e-11
ependymoma -3.000 6.0e-03
glioblastoma -3.400 1.7e-10
group 3 medulloblastoma -3.100 5.8e-04
interstitial cystitis -3.000 1.2e-03
lung adenocarcinoma 1.500 6.0e-03
medulloblastoma, large-cell -4.300 1.6e-07
nasopharyngeal carcinoma -1.400 5.3e-06
oligodendroglioma -2.400 8.2e-03
pituitary cancer -4.600 1.3e-05
primitive neuroectodermal tumor -2.600 2.5e-02
psoriasis 1.400 1.2e-23

Gene RIF (1)

AA Sequence

MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS        1 - 68
//

Text Mined References (7)

PMID Year Title