Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.98
PubTator Score 6.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.900 1.4e-03
Astrocytoma, Pilocytic 2.400 1.9e-07
Atopic dermatitis -2.900 1.2e-04
autosomal dominant Emery-Dreifuss muscul... 1.190 1.1e-02
breast carcinoma -2.700 2.3e-03
colon cancer -2.900 3.0e-06
cystic fibrosis 3.874 8.7e-07
ductal carcinoma in situ -4.400 6.0e-04
fascioscapulohumeral muscular dystrophy 1.645 2.2e-04
fibroadenoma -3.900 7.7e-03
glioblastoma 2.300 7.5e-06
group 3 medulloblastoma 2.700 1.1e-04
invasive ductal carcinoma -5.600 1.7e-04
lung adenocarcinoma -1.300 6.3e-11
lung cancer -1.600 2.7e-03
lung carcinoma -1.500 1.4e-10
nasopharyngeal carcinoma 2.000 1.1e-02
non-small cell lung cancer -2.492 1.3e-15
ovarian cancer -5.000 2.0e-16
psoriasis -1.700 5.8e-03

Gene RIF (4)

AA Sequence

MRGANAWAPLCLLLAAATQLSRQQSPERPVFTCGGILTGESGFIGSEGFPGVYPPNSKCTWKITVPEGKV      1 - 70
VVLNFRFIDLESDNLCRYDFVDVYNGHANGQRIGRFCGTFRPGALVSSGNKMMVQMISDANTAGNGFMAM     71 - 140
FSAAEPNERGDQYCGGLLDRPSGSFKTPNWPDRDYPAGVTCVWHIVAPKNQLIELKFEKFDVERDNYCRY    141 - 210
DYVAVFNGGEVNDARRIGKYCGDSPPAPIVSERNELLIQFLSDLSLTADGFIGHYIFRPKKLPTTTEQPV    211 - 280
TTTFPVTTGLKPTVALCQQKCRRTGTLEGNYCSSDFVLAGTVITTITRDGSLHATVSIINIYKEGNLAIQ    281 - 350
QAGKNMSARLTVVCKQCPLLRRGLNYIIMGQVGEDGRGKIMPNSFIMMFKTKNQKLLDALKNKQC         351 - 415
//

Text Mined References (15)

PMID Year Title