Property Summary

NCBI Gene PubMed Count 32
PubMed Score 50.92
PubTator Score 44.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
25286301 Results suggest that PCPE-1 binding to syndecans and/or fibronectin may control collagen fibril assembly on the cell surface.
24117177 The analysis of the PCPE-1 interaction network based on Gene Ontology terms suggests that, besides its role in collagen deposition, PCPE-1 might be involved in tumour growth, neurodegenerative diseases and angiogenesis.
23815790 The results of this study suggested that nuclear entrapment of PCOLCE and its extracellular depletion represents a novel molecular mechanism in late-onset muscle fibrosis.
23550162 Procollagen C-proteinase enhancer grasps the stalk of the C-propeptide trimer to boost collagen precursor maturation.
21940633 Procollagen C-proteinase enhancer stimulates procollagen processing by binding to the C-propeptide region only.
21569766 data generated by our system, support our hypothesis that combined data on PCPE concentration and isoforms may be useful for the diagnosis and follow-up of bone diseases
20729553 procollagen C-proteinase enhancer-1 (PCPE-1) binds to heparin/heparan sulfate and has a role in interaction with cells
20207734 Role of the netrin-like domain of procollagen C-proteinase enhancer-1 in the control of metalloproteinase activity.
19801683 Data show that only those containing both PCPE1 CUB1 and CUB2 were capable of enhancing BMP-1 activity and binding to a mini-procollagen substrate with nanomolar affinity.
19361460 the sPCPE1 glycopattern appears to be associated with the physiological and pathological states of bone
18350290 Procollagen I mRNA expression was decreased by synovial fluid from patients with prosthesis loosening.
18164932 PCPE-1 interacts with beta2-microglobulin (beta2-m) and may help initiate beta2-m amyloid fibril formation in connective tissues
17602227 in bone fracture patients, 12 proteins were related to bone/cartilage metabolism, including: TGF-beta induced protein IG-H(3), cartilage acidic protein 1, procollagen C proteinase enhancer protein and TGF-beta receptor III.
17446170 PCPE-stimulating activity requires a calcium binding motif in the CUB1 domain that is highly conserved among CUB-containing proteins
16507574 tolloid-like 1 binds procollagen C-proteinase enhancer protein 1 and differs from bone morphogenetic protein 1 in the functional roles of homologous protein domains
15817489 chordinase activity of BMP1 is not enhanced by PCPE-1
12670942 the three-dimensional structure of the NTR domain of human PCOLCE1 is the first example of a structural domain with the canonical features of an NTR module
12486138 procollagen C-proteinase enhancer is an elongated multidomain glycoprotein as shown by small angle x-ray scattering
12393877 PCPE1 and PCPE2 were found to be collagen-binding proteins, capable of binding at multiple sites on the triple helical portions of fibrillar collagens and also capable of competing for such binding with procollagen C-proteinases
12105202 PCPE binds to sites on either side of the procollagen cleavage site, thereby facilitating the action of procollagen C-proteinases.

AA Sequence

MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGDVKGESGYVASEGFPNLYPPNKECIWTITVP      1 - 70
EGQTVSLSFRVFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPLVAPGNQVTLRMTTDEGTGGR     71 - 140
GFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIALTFEKFDLEPD    141 - 210
TYCRYDSVSVFNGAVSDDSRRLGKFCGDAVPGSISSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKE    211 - 280
GQGPGPKRGTEPKVKLPPKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREP    281 - 350
GEGLAVTVSLIGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVL    351 - 420
HRPNQDQILTNLSKRKCPSQPVRAAASQD                                             421 - 449
//

Text Mined References (34)

PMID Year Title
25286301 2014 The NTR domain of procollagen C-proteinase enhancer-1 (PCPE-1) mediates PCPE-1 binding to syndecans-1, -2 and -4 as well as fibronectin.
24117177 2014 Extended interaction network of procollagen C-proteinase enhancer-1 in the extracellular matrix.
23815790 2013 Nuclear entrapment and extracellular depletion of PCOLCE is associated with muscle degeneration in oculopharyngeal muscular dystrophy.
23550162 2013 Procollagen C-proteinase enhancer grasps the stalk of the C-propeptide trimer to boost collagen precursor maturation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
21940633 2011 Procollagen C-proteinase enhancer stimulates procollagen processing by binding to the C-propeptide region only.
21569766 2011 Quantification of human serum procollagen C-proteinase enhancer (hsPCPE) glycopattern.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
20729553 2010 Binding of procollagen C-proteinase enhancer-1 (PCPE-1) to heparin/heparan sulfate: properties and role in PCPE-1 interaction with cells.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20207734 2010 Role of the netrin-like domain of procollagen C-proteinase enhancer-1 in the control of metalloproteinase activity.
19801683 2009 Strong cooperativity and loose geometry between CUB domains are the basis for procollagen c-proteinase enhancer activity.
19361460 2009 Different patterns of human serum procollagen C-proteinase enhancer1 (PCPE1).
18350290 2009 Effects of synovial fluid from aseptic prosthesis loosening on collagen production in osteoblasts.
18164932 2008 Procollagen C-proteinase enhancer-1 (PCPE-1) interacts with beta2-microglobulin (beta2-m) and may help initiate beta2-m amyloid fibril formation in connective tissues.
17602227 2007 Detection of bone and cartilage-related proteins in plasma of patients with a bone fracture using liquid chromatography-mass spectrometry.
17446170 2007 Insights into how CUB domains can exert specific functions while sharing a common fold: conserved and specific features of the CUB1 domain contribute to the molecular basis of procollagen C-proteinase enhancer-1 activity.
16507574 2006 Mammalian tolloid-like 1 binds procollagen C-proteinase enhancer protein 1 and differs from bone morphogenetic protein 1 in the functional roles of homologous protein domains.
15817489 2005 Identification of the minimal domain structure of bone morphogenetic protein-1 (BMP-1) for chordinase activity: chordinase activity is not enhanced by procollagen C-proteinase enhancer-1 (PCPE-1).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12670942 2003 NMR structure of the netrin-like domain (NTR) of human type I procollagen C-proteinase enhancer defines structural consensus of NTR domains and assesses potential proteinase inhibitory activity and ligand binding.
12486138 2003 Low resolution structure determination shows procollagen C-proteinase enhancer to be an elongated multidomain glycoprotein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393877 2002 PCOLCE2 encodes a functional procollagen C-proteinase enhancer (PCPE2) that is a collagen-binding protein differing in distribution of expression and post-translational modification from the previously described PCPE1.
12393284 2002 PCOLCE deletion and expression analyses in uterine leiomyomata.
12105202 2002 Interaction properties of the procollagen C-proteinase enhancer protein shed light on the mechanism of stimulation of BMP-1.
10625689 2000 Post-translational proteolytic processing of procollagen C-terminal proteinase enhancer releases a metalloproteinase inhibitor.
9933570 1999 Structural organization and expression patterns of the human and mouse genes for the type I procollagen COOH-terminal proteinase enhancer protein.
9799793 1998 Large-scale sequencing of two regions in human chromosome 7q22: analysis of 650 kb of genomic sequence around the EPO and CUTL1 loci reveals 17 genes.
8824813 1996 Fine mapping of the human and mouse genes for the type I procollagen COOH-terminal proteinase enhancer protein.
7523404 1994 Type I procollagen COOH-terminal proteinase enhancer protein: identification, primary structure, and chromosomal localization of the cognate human gene (PCOLCE).