Property Summary

Ligand Count 1
NCBI Gene PubMed Count 484
PubMed Score 11.26
PubTator Score 4332.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (27)

Disease log2 FC p
psoriasis 1.800 4.6e-04
acute quadriplegic myopathy 1.352 2.3e-08
adult high grade glioma 1.100 8.8e-03
astrocytoma 1.100 1.0e-11
atypical teratoid / rhabdoid tumor 1.100 7.4e-05
Breast cancer 3.600 3.8e-02
breast carcinoma 1.300 6.3e-30
dermatomyositis 1.400 5.5e-04
ductal carcinoma in situ 1.400 1.2e-03
Endometriosis 1.271 2.6e-02
glioblastoma 1.400 8.9e-07
group 3 medulloblastoma 2.000 1.8e-04
intraductal papillary-mucinous carcinoma... 1.100 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.400 2.4e-02
invasive ductal carcinoma 1.700 3.6e-04
juvenile dermatomyositis 1.014 1.3e-10
lung adenocarcinoma 1.129 6.2e-05
lung cancer 2.000 4.1e-04
medulloblastoma, large-cell 1.700 1.7e-05
nasopharyngeal carcinoma 1.400 2.6e-07
non-small cell lung cancer 1.339 1.8e-19
oligodendroglioma 1.200 1.8e-09
ovarian cancer 2.700 8.6e-05
pituitary cancer 1.100 3.1e-05
primary Sjogren syndrome 1.500 5.2e-03
primitive neuroectodermal tumor 1.600 5.4e-05
Waldenstrons macroglobulinemia 2.117 6.0e-03

Protein-protein Interaction (9)

PDB (27)

Gene RIF (333)

AA Sequence

MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGV      1 - 70
NLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMP     71 - 140
SGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALR    141 - 210
YLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS                       211 - 261
//

Text Mined References (500)

PMID Year Title