Property Summary

NCBI Gene PubMed Count 47
PubMed Score 65.07
PubTator Score 63.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.100 5.2e-03
hepatocellular carcinoma 1.200 1.1e-05
pancreatic cancer 1.100 5.3e-03
Waldenstrons macroglobulinemia 1.687 1.1e-03
Multiple myeloma 1.108 2.4e-03
astrocytic glioma -1.500 2.0e-02
ependymoma -1.600 3.0e-02
psoriasis 1.300 2.0e-04
glioblastoma -1.400 5.7e-05
atypical teratoid / rhabdoid tumor -1.600 6.2e-07
medulloblastoma, large-cell -1.800 1.4e-06
primitive neuroectodermal tumor -1.100 2.2e-05
tuberculosis and treatment for 6 months -1.100 2.3e-02
pancreatic ductal adenocarcinoma liver m... -1.730 8.9e-03
colon cancer 1.600 4.9e-02
breast carcinoma 1.100 2.2e-03
Breast cancer 2.800 2.6e-02
pancreatic carcinoma 1.100 5.3e-03
Pick disease -1.200 1.1e-03
ovarian cancer 2.300 6.7e-04
dermatomyositis 1.200 6.9e-03

Gene RIF (25)

PMID Text
26997432 Strong PIMT expression was a predictive marker of poor prognosis for surgically resected lung adenocarcinoma.
25800307 The data of this study indicated that DA-associated PIMT downregulation is an important event contributing to neuronal cell death
24358311 ERK2-mediated phosphorylation of transcriptional coactivator binding protein PIMT/NCoA6IP at Ser298 augments hepatic gluconeogenesis.
23903319 Data indicate that human PROTEIN ISOASPARTYL METHYLTRANSFERASE (PIMT) can initiate isoAsp conversion to Asp, and is able to restore Arabidopsis PRH75's complex biochemical activity provided isoAsp formation has not led to conformational alterations.
23647599 Overexpression of PCMT1 attentuates Mst1 kinase activation and its apoptotic effects in response to hypoxia-induced injury in cardiomyocytes.
22735455 Study provides new insight into the molecular mechanisms by which PIMT suppresses the p53 activity through carboxyl methylation, and suggests a therapeutic target for cancers.
22647835 The results implied that maternal polymorphisms in PCMT1 might be a potential genetic risk factor for isolated anencephaly in the Chinese population of Lvliang.
22382029 PIMT may act as a co-activator in ERalpha-mediated transcription of TFF1 through its recruitment to the promoter via interacting with ERalpha.
22033921 Control of PCMT1 expression by microRNA 15a/16-1 may thus represent a late checkpoint in apoptosis regulation
21841813 A tight cross-regulation exists between ERK and PIMT in regards to their activation and expression during the epithelial mesenchymal transition.
21839816 Data show six differentially expressed proteins were identified as HSP70, PPIA and alpha-Enolase (up-regulated) S100-A9, PIMT and beta-5 tubulin (down-regulated), most of which had been shown to play a potential role in the pathogenesis of atherosclerosis.
21372823 study demonstrates a novel role for PIMT as a negative regulator of Abeta peptide formation and a potential protective factor in the pathogenesis of Alzheimer disease
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19110265 This protein has been found differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18582870 Four polymorphisms in the protein L-isoaspartyl-O-methyltransferase (PCMT1) gene, encoding a protein repair enzyme, are associated with premature ovarian failure (POF).
18381200 These results suggest that PIMT repair of abnormal proteins is necessary to maintain normal MAPK signaling.
17167531 A potential role for PIMT in biological processes such as wound healing, cell migration, and tumor metastasis dissemination.
16256389 Observational study of gene-disease association. (HuGE Navigator)
16256389 Our results showed that the Ile120Val polymorphism of PCMT1 gene is a genetic modifier for the risk of spina bifida. Val/Val genotype was associated with a reduction in risk for spina bifida.
11847284 crystal structure complexed with adenosyl homocysteine (AdoHcy) to 1.6-A resolution
11792715 Protein L-Isoaspartyl Methyltransferase

AA Sequence

MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALE      1 - 70
LLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVV     71 - 140
GDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMG    141 - 210
VIYVPLTDKEKQWSRWK                                                         211 - 227
//

Text Mined References (53)

PMID Year Title
26997432 2016 Chaperone protein L-isoaspartate (D-aspartyl) O-methyltransferase as a novel predictor of poor prognosis in lung adenocarcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25800307 2015 The protein l-isoaspartyl (d-aspartyl) methyltransferase protects against dopamine-induced apoptosis in neuroblastoma SH-SY5Y cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24358311 2013 ERK2-mediated phosphorylation of transcriptional coactivator binding protein PIMT/NCoA6IP at Ser298 augments hepatic gluconeogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23903319 2013 An Arabidopsis ATP-dependent, DEAD-box RNA helicase loses activity upon IsoAsp formation but is restored by PROTEIN ISOASPARTYL METHYLTRANSFERASE.
23647599 2013 Protein-L-isoaspartate (D-aspartate) O-methyltransferase protects cardiomyocytes against hypoxia induced apoptosis through inhibiting proapoptotic kinase Mst1.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22735455 2012 Protein L-isoaspartyl methyltransferase regulates p53 activity.
22647835 2012 Maternal PCMT1 gene polymorphisms and the risk of neural tube defects in a Chinese population of Lvliang high-risk area.
22382029 2012 Requirement of protein l-isoaspartyl O-methyltransferase for transcriptional activation of trefoil factor 1 (TFF1) gene by estrogen receptor alpha.
22033921 2011 The microRNA 15a/16-1 cluster down-regulates protein repair isoaspartyl methyltransferase in hepatoma cells: implications for apoptosis regulation.
21841813 2011 Cross-regulation between protein L-isoaspartyl O-methyltransferase and ERK in epithelial mesenchymal transition of MDA-MB-231 cells.
21839816 2011 Pentoxifylline administration changes protein expression profile of coronary artery disease patients.
21372823 2011 Knock-down of protein L-isoaspartyl O-methyltransferase increases ?-amyloid production by decreasing ADAM10 and ADAM17 levels.
21269460 2011 Initial characterization of the human central proteome.
21204776 2011 Damaged proteins bearing L-isoaspartyl residues and aging: a dynamic equilibrium between generation of isomerized forms and repair by PIMT.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20562859 2010 Network organization of the human autophagy system.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19290383 2008 Posttranslational Protein Modifications in Type 1 Diabetes - Genetic Studies with PCMT1, the Repair Enzyme Protein Isoaspartate Methyltransferase (PIMT) Encoding Gene.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19110265 2009 Proteomic analysis of dorsolateral prefrontal cortex indicates the involvement of cytoskeleton, oligodendrocyte, energy metabolism and new potential markers in schizophrenia.
18582870 2009 Association between polymorphisms in the protein L-isoaspartate (D-aspartate) O-methyltransferase gene and premature ovarian failure.
18381200 2008 Suppression of protein l-isoaspartyl (d-aspartyl) methyltransferase results in hyperactivation of EGF-stimulated MEK-ERK signaling in cultured mammalian cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17167531 2006 Regulation of protein L-isoaspartyl methyltransferase by cell-matrix interactions: involvement of integrin alphavbeta3, PI 3-kinase, and the proteasome.
16256389 2006 A known functional polymorphism (Ile120Val) of the human PCMT1 gene and risk of spina bifida.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11847284 2002 Crystal structure of human L-isoaspartyl-O-methyl-transferase with S-adenosyl homocysteine at 1.6-A resolution and modeling of an isoaspartyl-containing peptide at the active site.
11792715 2002 Crystal structure of human L-isoaspartyl methyltransferase.
10496068 1999 Polymorphic forms of the protein L-isoaspartate (D-aspartate) O-methyltransferase involved in the repair of age-damaged proteins.
10343128 1999 Assignment of the protein L-isoaspartate (D-aspartate) O-methyltransferase gene (PCMT1) to human chromosome bands 6q24-->q25 with radiation hybrid mapping.
8914929 1996 Structure of the human gene encoding the protein repair L-isoaspartyl (D-aspartyl) O-methyltransferase.
8074695 1994 Amino acid polymorphisms of the human L-isoaspartyl/D-aspartyl methyltransferase involved in protein repair.
7592526 1995 Characterization of three cDNAs encoding two isozymes of an isoaspartyl protein carboxyl methyltransferase from human erythroid leukemia cells.
3355545 1988 Two major isozymes of the protein D-aspartyl/L-isoaspartyl methyltransferase from human erythrocytes.
3167043 1988 Purification of homologous protein carboxyl methyltransferase isozymes from human and bovine erythrocytes.
2684970 1989 Sequence of the D-aspartyl/L-isoaspartyl protein methyltransferase from human erythrocytes. Common sequence motifs for protein, DNA, RNA, and small molecule S-adenosylmethionine-dependent methyltransferases.
1998518 1991 Distinct C-terminal sequences of isozymes I and II of the human erythrocyte L-isoaspartyl/D-aspartyl protein methyltransferase.
1478665 1992 The L-isoaspartyl/D-aspartyl protein methyltransferase gene (PCMT1) maps to human chromosome 6q22.3-6q24 and the syntenic region of mouse chromosome 10.
1339271 1992 Alternative splicing of the human isoaspartyl protein carboxyl methyltransferase RNA leads to the generation of a C-terminal -RDEL sequence in isozyme II.