Property Summary

NCBI Gene PubMed Count 36
PubMed Score 2307.05
PubTator Score 668.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
IGA Glomerulonephritis 454

Expression

  Differential Expression (38)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.177 2.0e-02
Multiple myeloma 1.097 4.6e-02
malignant mesothelioma 1.400 9.1e-06
astrocytic glioma 1.200 1.7e-02
posterior fossa group A ependymoma 3.300 3.7e-09
oligodendroglioma 1.500 1.7e-06
psoriasis 2.800 3.0e-15
glioblastoma 4.000 1.7e-13
group 3 medulloblastoma 5.700 4.1e-08
atypical teratoid/rhabdoid tumor 4.700 6.9e-16
medulloblastoma, large-cell 5.200 1.2e-06
primitive neuroectodermal tumor 4.400 5.6e-07
juvenile dermatomyositis 1.033 5.3e-09
Atopic dermatitis 1.700 1.3e-04
adrenocortical carcinoma 4.381 1.6e-08
tuberculosis 1.700 1.8e-04
pancreatic ductal adenocarcinoma liver m... 1.938 8.6e-03
non-small cell lung cancer 3.757 2.0e-30
intraductal papillary-mucinous carcinoma... 2.800 2.9e-03
intraductal papillary-mucinous neoplasm ... 3.900 4.6e-03
lung cancer 4.500 2.0e-06
pancreatic cancer 1.500 9.7e-06
breast carcinoma 2.600 6.1e-07
interstitial cystitis 1.300 4.9e-03
lung adenocarcinoma 1.776 1.5e-06
pediatric high grade glioma 4.100 5.5e-09
pilocytic astrocytoma 1.600 2.1e-04
primary Sjogren syndrome 1.800 9.1e-04
nasopharyngeal carcinoma 1.600 2.4e-05
Endometriosis 1.991 1.4e-02
Breast cancer 3.300 2.1e-10
COPD 1.300 4.8e-02
ductal carcinoma in situ 3.800 5.3e-04
invasive ductal carcinoma 4.700 5.0e-04
ulcerative colitis 1.300 2.7e-06
ovarian cancer 2.800 6.1e-04
chronic rhinosinusitis 1.069 2.9e-02
cystic fibrosis and chronic rhinosinusit... 1.302 2.0e-03

 GO Function (1)

Gene RIF (27)

PMID Text
26843124 Results unveil an unsuspected role of the PAF-Wnt signalling axis in modulating cell plasticity, which is required for the maintenance of breast cancer cell stemness.
26155891 IN PATIENTS WITH HEPATITIS C VIRUS GENOTYPE 1B, TREATMENT RESPONSE WITH DACLATASVIR PLUS ASUNAPREVIR WITHOUT NS5A-L31F/I/M/V and/or NS5A-Y93H polymorphisms
25762514 p15PAF acts as a flexible drag that regulates PCNA sliding along the DNA and facilitates the switch from replicative to translesion synthesis polymerase binding.
25649430 Results indicated that the expression of NS5ATP9 was up-regulated by starvation and that Beclin 1 was involved in autophagy induced in hepatoblastoma cells by starvation.
24996800 NS5ATP9 mRNA overexpression in peripheral blood mononuclear cells was significantly associated with poor disease-free survival and overall survival of gastric cancer patients, but not with tumor recurrence.
24750205 These results highlight an important potential role for NS5ATP9 in hepatitis C virus NS5A-induced hepatocyte autophagy.
24197986 overexpression of KIAA0101 mRNA in peripheral blood mononuclear cells could act as a predictive biomarker for hepatic cancer
24145239 Upregulated expression of KIAA0101 is associated with esophageal cancer progression, resistance to chemotherapy, and poor survival.
24055345 Data indicate that PAF-EZH2-beta-catenin complex hyperactivates Wnt signaling.
23698777 Data show that hepatitis C virus NS5A-transactivated protein 9 (NS5ATP9) knockdown activated mitogen-activated protein kinase kinase/extracellular signal regulated kinases 1/2 signaling under C virus nonstructural protein 5A (NS5A) expression.
23593430 p15(PAF) is tightly regulated by the Rb/E2F complex. Loss of Rb/E2F-mediated repression during the G1/S transition phase leads to p15(PAF) upregulation, which facilitates DNA synthesis and S-phase progression.
23240630 GC patients with elevated KIAA0101 expression levels exhibited a high recurrence and subsequently poor prognosis in the survival study
23209346 Low expression of PAF and high expression of TNF-alpha in leukocytospermia affect the sperm motility, which is one of the reasons that leads to infertility.
23157749 Down-regulation of KIAA0101 expression leads to an inhibition of cell proliferation, cell cycle and cell invasion of gastric carcinoma.
23000965 The results uncovered a critical role for PCNA-associated factor PAF15 (p15(PAF)/KIAA0101) ubiquitylation during DNA replication. During unperturbed S phase, chromatin-associated PAF15 is modified by double mono-ubiquitylation of lysine 15 and 24.
22576474 KIAA0101 transcript variant 1 may function as a regulator, promoting cell survival in hepatocellular carcinoma through regulating the function of p53.
22096502 Data supports that KIAA0101 is a marker of cellular proliferation, promotes growth and invasion, and is a good diagnostic marker for distinguishing benign from malignant adrenocortical neoplasm.
21689861 High-level KIAA0101 expression was observed in 33.9% (121 of 357 cases).
21673012 This study identifies KIAA0101 as a protein important for breast tumorigenesis, and as this factor has been reported as a UV repair factor, it may link the UV damage response to centrosome control
21628590 Data indicate that PAF15 associates with PCNA, and depletion of PAF15 decreases the number of cells in S phase, suggesting a role for it in cell cycle regulation.
20118010 KIAA0101 gene may participate in cell cycle regulation of non-small cell lung cancer.
19219066 Interaction between p15(PAF)and Proliferating Cell Nuclear Antigen is required for the DNA repair process.
18727915 p15(PAF) gene is regulated by NF-kappa B signal transduction.
18068894 NS5ATP9 is a NS5A up-regulation gene which may play a role in the pathogenesis of HCV-associated hepatocellular carcinoma.
16646990 KIAA0101 protein expression was down-regulated in hepatocellular carcinoma; this gene could inhibit the HCC cell growth in vitro and presumably by its blocking effect on cell cycle
16288740 The PCNA-associated factor KIAA0101/p15(PAF) binds the potential tumor suppressor product p33ING1b.
15789362 Overexpression of KIAA0101 is associated with anaplastic thyroid carcinoma

AA Sequence

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFR      1 - 70
LSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE                                  71 - 111
//

Text Mined References (39)

PMID Year Title
26843124 2016 PAF-Wnt signaling-induced cell plasticity is required for maintenance of breast cancer cell stemness.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26155891 2015 High Sustained Virologic Response to Daclatasvir Plus Asunaprevir in Elderly and Cirrhotic Patients with Hepatitis C Virus Genotype 1b Without Baseline NS5A Polymorphisms.
25762514 2015 Structure of p15(PAF)-PCNA complex and implications for clamp sliding during DNA replication and repair.
25649430 2015 NS5ATP9 Promotes Beclin 1-Dependent Starvation-Induced Autophagy of Hepatoblastoma Cells.
24996800 2014 NS5ATP9 mRNA levels in peripheral blood mononuclear cells predict prognosis in patients with gastric cancer.
24750205 2014 A functional role for NS5ATP9 in the induction of HCV NS5A-mediated autophagy.
24197986 2014 KIAA0101 mRNA overexpression in peripheral blood mononuclear cells acts as predictive marker for hepatic cancer.
24145239 2013 Expression of KIAA0101 protein is associated with poor survival of esophageal cancer patients and resistance to cisplatin treatment in vitro.
24055345 2013 PAF and EZH2 induce Wnt/?-catenin signaling hyperactivation.
23698777 2013 NS5ATP9 contributes to inhibition of cell proliferation by hepatitis C virus (HCV) nonstructural protein 5A (NS5A) via MEK/extracellular signal regulated kinase (ERK) pathway.
23593430 2013 p15(PAF) is an Rb/E2F-regulated S-phase protein essential for DNA synthesis and cell cycle progression.
23240630 2013 Elevated KIAA0101 expression is a marker of recurrence in human gastric cancer.
23209346 2012 Clinical significance and expression of PAF and TNF-alpha in seminal plasma of leukocytospermic patients.
23157749 2012 [Effects of KIAA0101 expression on proliferation and invasion of gastric carcinoma MKN-45 cells].
23000965 2012 Systems-wide analysis of ubiquitylation dynamics reveals a key role for PAF15 ubiquitylation in DNA-damage bypass.
22576474 2012 Variant 1 of KIAA0101, overexpressed in hepatocellular carcinoma, prevents doxorubicin-induced apoptosis by inhibiting p53 activation.
22096502 2011 KIAA0101 is overexpressed, and promotes growth and invasion in adrenal cancer.
21700221 2011 Regulation of ubiquitin chain initiation to control the timing of substrate degradation.
21689861 2012 Overexpression of KIAA0101 predicts poor prognosis in primary lung cancer patients.
21673012 2011 KIAA0101 interacts with BRCA1 and regulates centrosome number.
21628590 2011 Proliferating cell nuclear antigen (PCNA)-associated KIAA0101/PAF15 protein is a cell cycle-regulated anaphase-promoting complex/cyclosome substrate.
20118010 2010 [Functional prediction of KIAA0101 gene in human non-small cell lung cancer].
19219066 2009 ATF3 and p15PAF are novel gatekeepers of genomic integrity upon UV stress.
18727915 2008 NS5ATP9 gene regulated by NF-kappaB signal pathway.
18068894 2008 NS5ATP9, a gene up-regulated by HCV NS5A protein.
17875765 2007 Overexpression of KIAA0101 predicts high stage, early tumor recurrence, and poor prognosis of hepatocellular carcinoma.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16646990 2006 KIAA0101 (OEACT-1), an expressionally down-regulated and growth-inhibitory gene in human hepatocellular carcinoma.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16288740 2006 The PCNA-associated factor KIAA0101/p15(PAF) binds the potential tumor suppressor product p33ING1b.
15789362 2005 Overexpressed in anaplastic thyroid carcinoma-1 (OEATC-1) as a novel gene responsible for anaplastic thyroid carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334068 2004 Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11313979 2001 p15(PAF), a novel PCNA associated factor with increased expression in tumor tissues.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.