Property Summary

NCBI Gene PubMed Count 27
PubMed Score 174.23
PubTator Score 232.19

Knowledge Summary

Patent (36,032)

Expression

  Differential Expression (9)

Disease log2 FC p
group 3 medulloblastoma 2.100 8.9e-06
malignant mesothelioma 1.300 3.2e-06
nephrosclerosis -1.498 3.0e-02
osteosarcoma -1.693 1.7e-03
ovarian cancer 1.200 1.9e-03
pancreatic ductal adenocarcinoma liver m... -1.261 2.1e-02
Polycystic ovary syndrome -1.197 4.9e-02
subependymal giant cell astrocytoma 1.458 2.0e-02
ulcerative colitis -1.300 2.2e-09

Gene RIF (21)

AA Sequence

MAALYRPGLRLNWHGLSPLGWPSCRSIQTLRVLSGDLGQLPTGIRDFVEHSARLCQPEGIHICDGTEAEN      1 - 70
TATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTVQLPPGGARGQLGNWMSPADF     71 - 140
QRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFVKC    141 - 210
LHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLA    211 - 280
EHMLILGITSPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGF    281 - 350
FGVAPGTSATTNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLPPGVTVTSWLGKPWKPGDKEPCAHP    351 - 420
NSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKG    421 - 490
KIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRRDEAGHFLWPGFGENARVLDWICR    491 - 560
RLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAEL    561 - 630
EALERRVHKM                                                                631 - 640
//

Text Mined References (31)

PMID Year Title