Property Summary

NCBI Gene PubMed Count 63
PubMed Score 191.22
PubTator Score 483.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
nephrosclerosis -2.161 1.2e-02
autosomal dominant Emery-Dreifuss muscul... 1.129 1.2e-02
Atopic dermatitis -2.100 1.2e-02
colon cancer -3.700 3.0e-02
lung cancer 5.300 9.8e-07
breast carcinoma -1.800 4.7e-03
fibroadenoma -2.300 3.8e-02
psoriasis -1.700 1.0e-11
lung carcinoma 4.100 7.2e-19
ductal carcinoma in situ -4.300 2.7e-04
invasive ductal carcinoma -5.300 2.5e-04
ulcerative colitis -5.200 6.3e-08
pituitary cancer -6.400 3.5e-16

Gene RIF (50)

PMID Text
26528723 an extended binding site in the catalytic cleft of cPEPCK which is used by 3-MPA to inhibit cPEPCK non-competitively.
25736587 Insulin-dependent translocation of FOXO1 regulated transcriptional repression of PCK1 concomitant with the formation of the FOXO1-euchromatic histone-lysine N-methyltransferase2 (EHMT2) complex and histone modifications of the PCK1 promoter region
24863970 A mutation of PCK1 associated with Smith-Magenis Syndrome, cytosolic PEPCK deficiency and NMDA receptor glutamate insensitivity.
23465595 Lipopolysaccharide and monophosphoryl lipid A also up-regulated G6PC and PCK1 transcript abundance in a TLR4-dependent manner.
23092637 The PCK1 tag-single nucleotide polymorphisms influenced insulin resistance by interacting with plasma n-3 polyunsaturated fatty acids levels in metabolic syndrome patients.
22489460 HCV core protein expression-mediated FOXO1 activation and the increased PGC-1alpha leaded to the elevation of PCK1 at the mRNA level
21726808 Acetylation regulates the stability of the gluconeogenic rate-limiting enzyme PEPCK1.
21152065 Studies demonstrate the association between PCK1 and smaller average brain volume.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20691246 Data show PEPCK-C and CPT-1 mRNAs are more abundant in non-tumoral tissues than in the tumoral counterpart, whereas the opposite occurred for the FAS gene.
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20574532 Observational study of gene-disease association. (HuGE Navigator)
20134411 Study in the EYHS cohort failed to identify an association of PCK1 polymorphisms with obesity, physical activity, and fitness.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19725958 study is the first to investigate the association between variants of the PCK1 gene and type 2 diabetes in South Asians
19725958 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19329064 Study validated a predicted SP1 binding site in the control of PCK1 transcription using gel shift and reporter assays.
19070910 Val184 of PCK1 gene might increase the risk of type 2 diabetes in eastern Chinese population with BMI<23 kg/m(2) via reducing the PEPCK-C activity.
19070910 Observational study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19021757 The aromatic ring of Tyr235 in PEPCK helps to position PEP in the active site and the hydroxyl group allows an optimal PEP-Mn(2+) distance for efficient phosphoryl transfer and overall catalysis.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18976975 Knockdown of phosphoenolpyruvate carboxykinase 1 (PCK1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18830724 Meta-analysis of gene-disease association. (HuGE Navigator)
18801732 Reduced CREB phosphorylation (Ser-129) associated with inactivation of GSK3beta by Ser-9 phosphorylation may be the major mechanism underlying PEPCK-C gene suppression by AMPK-activating agents such as biguanide
18660489 Observational study of gene-disease association. (HuGE Navigator)
18492826 The effects of several variants of retinoic acid on the expression and activity of PEPCK in human, mouse, and rat adipose tissue are reported.
18460190 Observational study of gene-disease association. (HuGE Navigator)
17495004 IFN-gamma exerts a tissue-specific action in rodents and humans, having glyceroneogenesis and the PEPCK-C gene as selective targets to intensify fatty acids release from adipocytes
17440948 Observational study of gene-disease association. (HuGE Navigator)
17440948 Significant association of single nucleotide polymorphism within three genes--PPARgamma, SOS2, and PCK1--with Alzheimer's disease, was confirmed.
17192490 Observational study of gene-disease association. (HuGE Navigator)
16978381 Observational study of gene-disease association. (HuGE Navigator)
16620271 Observational study of gene-disease association. (HuGE Navigator)
16282543 Observational study of gene-disease association. (HuGE Navigator)
16282543 Subjects with the PCK1-232G/G genotype had more carotid IMT (0.80+/-0.02 versus 0.73+/-0.03 mm; P=0.007) but less TPV (0.10+/-0.09 versus 0.38+/-0.13; P=0.03) than subjects with other genotypes.
16144962 The multiple instability elements present within the 3'-UTR may function synergistically to mediate both the rapid degradation and the cAMP-induced stabilization of PEPCK mRNA. The latter process may result from a PKA-dependent phosphorylation of AUF1.
16132948 Observational study of gene-disease association. (HuGE Navigator)
15951444 AUF1 binds to multiple destabilizing elements within the 3'-UTR that participate in the rapid turnover of the phosphoenolpyruvate carboxykinase mRNA.
15046742 PCK1 has been implicated as one of many genes associated with type 2 diabetes mellitus [review]
14764811 Promoter single nucleotide polymorphism in PCK1 was resistant to down-regulation by insulin in vitro and associated with type 2 diabetes mellitus.
14744869 transcription of the gene for phosphoenolpyruvate carboxykinase (GTP) in the liver is regulated by SREBP-1c and Sp1
12324453 the PGC- 1-regulated phospho(enol)pyruvate carboxykinase (PEPCK) promoter is a novel target promoter for SHP inhibition
12237288 promoter context may influence which domains within a transcription factor are employed to mediate transactivation of PEPCK
11997389 Conserved amino acids within CCAAT enhancer-binding proteins (C/EBP(alpha) and beta) regulate gene expression
11851336 crystal structure of human cytosolic phosphoenolpyruvate carboxykinase reveals a new GTP-binding site
11689615 Interaction of human PCK1 with HIV-1 integrase is presumed based on a reported binding interaction between yeast PCK1 and integrase

AA Sequence

MPPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQMEEEGILRRLK      1 - 70
KYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQLGRWMSEEDFEKAFNARFPGCMKGRTMY     71 - 140
VIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPVLEAVGDGEFVKCLHSVGCPLPLQKPLVNNW    141 - 210
PCNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYL    211 - 280
AAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKT    281 - 350
IQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAW    351 - 420
ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPFAMRPFFGYNF    421 - 490
GKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPK    491 - 560
EDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQVNADLPCEIEREILALKQRISQM            561 - 622
//

Text Mined References (68)

PMID Year Title
26528723 2015 Mixed Inhibition of cPEPCK by Genistein, Using an Extended Binding Site Located Adjacent to Its Catalytic Cleft.
25736587 2015 Translocation of forkhead box O1 to the nuclear periphery induces histone modifications that regulate transcriptional repression of PCK1 in HepG2 cells.
24863970 2014 Three rare diseases in one Sib pair: RAI1, PCK1, GRIN2B mutations associated with Smith-Magenis Syndrome, cytosolic PEPCK deficiency and NMDA receptor glutamate insensitivity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23465595 2013 Toll-like receptor 4 signaling is required for induction of gluconeogenic gene expression by palmitate in human hepatic carcinoma cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23300278 2013 Genome-wide association study identifies a novel locus contributing to type 2 diabetes susceptibility in Sikhs of Punjabi origin from India.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
23092637 2013 Gene-nutrient interactions on the phosphoenolpyruvate carboxykinase influence insulin sensitivity in metabolic syndrome subjects.
22489460 2012 [Hepatitis C virus core protein upregulates the transcription of PCK1 through FOXO1/PGC-1alpha pathway].
21726808 2011 Acetylation regulates gluconeogenesis by promoting PEPCK1 degradation via recruiting the UBR5 ubiquitin ligase.
21152065 2010 A putative Alzheimer's disease risk allele in PCK1 influences brain atrophy in multiple sclerosis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20691246 2010 Down-regulation of the phosphoenolpyruvate carboxykinase gene in human colon tumors and induction by omega-3 fatty acids.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20574532 2010 Intermediate phenotypes identify divergent pathways to Alzheimer's disease.
20167786 2010 Regulation of cellular metabolism by protein lysine acetylation.
20134411 2010 Lack of association between PCK1 polymorphisms and obesity, physical activity, and fitness in European Youth Heart Study (EYHS).
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19725958 2009 The promoter polymorphism -232C/G of the PCK1 gene is associated with type 2 diabetes in a UK-resident South Asian population.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19329064 2008 Identification of conserved regulatory elements in mammalian promoter regions: a case study using the PCK1 promoter.
19070910 2009 A Leu184Val polymorphism in PCK1 gene is associated with type 2 diabetes in Eastern Chinese population with BMI<23 kg/m2.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19021757 2008 Tyr235 of human cytosolic phosphoenolpyruvate carboxykinase influences catalysis through an anion-quadrupole interaction with phosphoenolpyruvate carboxylate.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18830724 2009 Assessment of Alzheimer's disease case-control associations using family-based methods.
18801732 2008 AMP-activated protein kinase activation increases phosphorylation of glycogen synthase kinase 3beta and thereby reduces cAMP-responsive element transcriptional activity and phosphoenolpyruvate carboxykinase C gene expression in the liver.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18492826 2008 Retinoids upregulate phosphoenolpyruvate carboxykinase and glyceroneogenesis in human and rodent adipocytes.
18460190 2008 The estrogen hypothesis of schizophrenia implicates glucose metabolism: association study in three independent samples.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17532214 2007 C-8 Modifications of 3-alkyl-1,8-dibenzylxanthines as inhibitors of human cytosolic phosphoenolpyruvate carboxykinase.
17495004 2007 Acute and selective inhibition of adipocyte glyceroneogenesis and cytosolic phosphoenolpyruvate carboxykinase by interferon gamma.
17440948 2007 Candidate gene association study of insulin signaling genes and Alzheimer's disease: evidence for SOS2, PCK1, and PPARgamma as susceptibility loci.
17192490 2007 Screening of 134 single nucleotide polymorphisms (SNPs) previously associated with type 2 diabetes replicates association with 12 SNPs in nine genes.
16978381 2006 Large-scale study of the -232C > G polymorphism of PCK1 in Type 2 diabetes.
16620271 2006 Association of the promoter polymorphism -232C/G of the phosphoenolpyruvate carboxykinase gene (PCK1) with Type 2 diabetes mellitus.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16282543 2005 Disparate associations of a functional promoter polymorphism in PCK1 with carotid wall ultrasound traits.
16144962 2006 cAMP-dependent stabilization of phosphoenolpyruvate carboxykinase mRNA in LLC-PK1-F+ kidney cells.
16132948 2005 Association of a polymorphism in the gene encoding phosphoenolpyruvate carboxykinase 1 with high-density lipoprotein and triglyceride levels.
15951444 2005 3'-Untranslated region of phosphoenolpyruvate carboxykinase mRNA contains multiple instability elements that bind AUF1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15046742 2004 Disregulated glyceroneogenesis: PCK1 as a candidate diabetes and obesity gene.
14764811 2004 Promoter polymorphism in PCK1 (phosphoenolpyruvate carboxykinase gene) associated with type 2 diabetes mellitus.
14744869 2004 SREBP-1c and Sp1 interact to regulate transcription of the gene for phosphoenolpyruvate carboxykinase (GTP) in the liver.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14552798 2003 X-ray structures of two xanthine inhibitors bound to PEPCK and N-3 modifications of substituted 1,8-dibenzylxanthines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12324453 2002 Glucocorticoid signaling is perturbed by the atypical orphan receptor and corepressor SHP.
12237288 2002 Different transcription factor binding arrays modulate the cAMP responsivity of the phosphoenolpyruvate carboxykinase gene promoter.
11997389 2002 Conserved amino acids within CCAAT enhancer-binding proteins (C/EBP(alpha) and beta) regulate phosphoenolpyruvate carboxykinase (PEPCK) gene expression.
11851336 2002 Crystal structure of human cytosolic phosphoenolpyruvate carboxykinase reveals a new GTP-binding site.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11689615 2001 Functional interactions of human immunodeficiency virus type 1 integrase with human and yeast HSP60.
8547315 1995 Structural and functional analysis of the human phosphoenolpyruvate carboxykinase gene promoter.
8490617 1993 cDNA sequence and localization of polymorphic human cytosolic phosphoenolpyruvate carboxykinase gene (PCK1) to chromosome 20, band q13.31: PCK1 is not tightly linked to maturity-onset diabetes of the young.
8432541 1993 Human PCK1 encoding phosphoenolpyruvate carboxykinase is located on chromosome 20q13.2.
8325643 1993 Phosphoenolpyruvate carboxykinase (GTP): characterization of the human PCK1 gene and localization distal to MODY on chromosome 20.
2993287 1985 Rat hepatic cytosolic phosphoenolpyruvate carboxykinase (GTP). Structures of the protein, messenger RNA, and gene.
1657985 1991 Identification of a thyroid hormone response element in the phosphoenolpyruvate carboxykinase (GTP) gene. Evidence for synergistic interaction between thyroid hormone and cAMP cis-regulatory elements.
1656199 1991 Regulation of phosphoenolpyruvate carboxykinase (GTP) gene transcription.
1492743 1992 The genes coding for phosphoenolpyruvate carboxykinase-1 (PCK1) and neuronal nicotinic acetylcholine receptor alpha 4 subunit (CHRNA4) map to human chromosome 20, extending the known region of homology with mouse chromosome 2.