Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.53
PubTator Score 5.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
hepatocellular carcinoma -1.500 5.1e-05
malignant mesothelioma 1.300 4.9e-06
astrocytic glioma -1.100 2.7e-02
oligodendroglioma -1.100 2.0e-02
cutaneous lupus erythematosus -1.100 1.0e-03
osteosarcoma -2.039 1.1e-08
atypical teratoid / rhabdoid tumor 1.100 3.6e-04
glioblastoma 1.300 8.0e-07
medulloblastoma 1.500 5.7e-07
medulloblastoma, large-cell 1.600 9.2e-06
tuberculosis and treatment for 6 months 1.600 2.0e-05
lung cancer 1.700 1.1e-02

Synonym

Accession Q9H4Z3 E1P5P1 Q54AB9 Q9NT85
Symbols C20orf67
PPP1R121

Gene

PDB

2JX8  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
19682092 These results suggest that Pin1 may have overlapping cellular function with PCIF1.
18294453 These data suggest that icariin exerts its potent osteogenic effect through induction of Runx2 expression, production of BMP-4 and activation of BMP signaling.
12565871 Data suggest that phosphorylated CTD interacting factor 1 (PCIF1) may play a role in mRNA synthesis by modulating RNA polymerase II activity.

AA Sequence

MANENHGSPREEASLLSHSPGTSNQSQPCSPKPIRLVQDLPEELVHAGWEKCWSRRENRPYYFNRFTNQS      1 - 70
LWEMPVLGQHDVISDPLGLNATPLPQDSSLVETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQS     71 - 140
VPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHRGPSEVLPPHPEVELLRSQLIL    141 - 210
KLRQHYRELCQQREGIEPPRESFNRWMLERKVVDKGSDPLLPSNCEPVVSPSMFREIMNDIPIRLSRIKF    211 - 280
REEAKRLLFKYAEAARRLIESRSASPDSRKVVKWNVEDTFSWLRKDHSASKEDYMDRLEHLRRQCGPHVS    281 - 350
AAAKDSVEGICSKIYHISLEYVKRIREKHLAILKENNISEEVEAPEVEPRLVYCYPVRLAVSAPPMPSVE    351 - 420
MHMENNVVCIRYKGEMVKVSRNYFSKLWLLYRYSCIDDSAFERFLPRVWCLLRRYQMMFGVGLYEGTGLQ    421 - 490
GSLPVHVFEALHRLFGVSFECFASPLNCYFRQYCSAFPDTDGYFGSRGPCLDFAPLSGSFEANPPFCEEL    491 - 560
MDAMVSHFERLLESSPEPLSFIVFIPEWREPPTPALTRMEQSRFKRHQLILPAFEHEYRSGSQHICKKEE    561 - 630
MHYKAVHNTAVLFLQNDPGFAKWAPTPERLQELSAAYRQSGRSHSSGSSSSSSSEAKDRDSGREQGPSRE    631 - 700
PHPT                                                                      701 - 704
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19682092 2009 Prolyl isomerase Pin1 shares functional similarity with phosphorylated CTD interacting factor PCIF1 in vertebrate cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18294453 2008 Human phosphorylated CTD-interacting protein, PCIF1, negatively modulates gene expression by RNA polymerase II.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15121856 2004 Identification of PCIF1, a POZ domain protein that inhibits PDX-1 (MODY4) transcriptional activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12565871 2003 PCIF1, a novel human WW domain-containing protein, interacts with the phosphorylated RNA polymerase II.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.