Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 1.0e-07
ovarian cancer 8520 7.5e-07
osteosarcoma 7950 3.9e-03
oligodendroglioma 2850 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.300 1.1e-02
osteosarcoma -1.133 3.9e-03
ovarian cancer -1.100 7.5e-07
tuberculosis 1.400 1.0e-07

AA Sequence

MVFCLSSEEPRRPLRSDMVHFQASEVQQLLHNKFVVILGDSIQRAVYKDLVLLLQKDSLLTAAQLKAKGE      1 - 70
LSFEQDQLVAGGQLGELHNGTQYREVRQFCSGSGHHLVRFYFLTRVYSEYLEDVLEELTYGPAPDLVIIN     71 - 140
SCLWDLSRYGRCSMESYRENLERVFVRMDQVLPDSCLLVWNMAMPLGERITGGFLLPELQPLAGSLRRDV    141 - 210
VEGNFYSATLAGDHCFDVLDLHFHFRHAVQHRHRDGVHWDQHAHRHLSHLLLTHVADAWGVELPKRGYPP    211 - 280
DPWIEDWAEMNHPFQGSHRQTPDFGEHLALLPPPPSSLPPPMPFPYPLPQPSPPPLFPPLPQDTPFFPGQ    281 - 350
PFPPHEFFNYNPVEDFSMPPHLGCGPGVNFVPGPLPPPIPGPNPHGQHWGPVVHRGMPRYVPNSPYHVRR    351 - 420
MGGPCRQRLRHSERLIHTYKLDRRPPAHSGTWPG                                        421 - 454
//

Text Mined References (11)

PMID Year Title