Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.14
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 2.800 1.2e-04
astrocytoma 1.400 7.4e-07
Astrocytoma, Pilocytic 1.700 8.4e-06
atypical teratoid / rhabdoid tumor 1.600 1.9e-02
Breast cancer -1.600 3.3e-04
glioblastoma 2.200 1.2e-05
group 3 medulloblastoma 2.400 2.7e-03
invasive ductal carcinoma -1.400 4.4e-02
medulloblastoma, large-cell 2.300 6.3e-04
oligodendroglioma 2.100 1.1e-02
ovarian cancer -2.300 1.2e-04
Pick disease 1.600 1.5e-03
primitive neuroectodermal tumor 1.800 1.5e-02

AA Sequence

MEIGWMHNRRQRQVLVFFVLLSLSGAGAELGSYSVVEETERGSFVANLGKDLGLGLTEMSTRKARIISQG      1 - 70
NKQHLQLKAQTGDLLINEKLDREELCGPTEPCILHFQVLMENPLEIFQAELRVIDINDHSPMFTEKEMIL     71 - 140
KIPENSPLGTEFPLNHALDLDVGSNNVQNYKISPSSHFRVLIHEFRDGRKYPELVLDKELDREEEPQLRL    141 - 210
TLTALDGGSPPRSGTAQVRIEVVDINDNAPEFEQPIYKVQIPENSPLGSLVATVSARDLDGGANGKISYT    211 - 280
LFQPSEDISKTLEVNPMTGEVRLRKQVDFEMVTSYEVRIKATDGGGLSGKCTLLLQVVDVNDNPPQVTMS    281 - 350
ALTSPIPENSPEIVVAVFSVSDPDSGNNGKTISSIQEDLPFLLKPSVKNFYTLVTERALDREARAEYNIT    351 - 420
LTVTDMGTPRLKTEHNITVQISDVNDNAPTFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSL    421 - 490
LPPQDPHLPLASLVSINADNGHLFALRSLDYEALREFEFRVSATDRGSPALSSEALVRVLVLDANDNSPF    491 - 560
VLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLL    561 - 630
SERDAAKQRLVVLVKDNGEPPRSATATLHVLLVDGFSQPFLPLPEAAPGQTQANSLTVYLVVALASVSSL    631 - 700
FLFSVLLFVAVRLCRRSRAASVGRCSMPEGPFPGRLVDVSGTGTLSQSYQYEVCLTGGSETSEFKFLKPI    701 - 770
IPNFSP                                                                    771 - 776
//

Text Mined References (14)

PMID Year Title