Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.34
PubTator Score 8.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Asthma 349 0.0 1.0
Crohn's disease 304 0.0 1.0
Dental caries 67 0.0 1.0
Obesity 616 0.0 1.0

Expression

  Differential Expression (32)

Disease log2 FC p
malignant mesothelioma -3.700 2.0e-09
astrocytoma -1.100 5.0e-09
glioblastoma -3.200 2.8e-05
oligodendroglioma -1.300 2.2e-07
osteosarcoma 1.963 9.5e-03
ependymoma -2.300 2.1e-07
group 4 medulloblastoma -5.100 3.8e-11
cystic fibrosis 1.366 1.6e-05
atypical teratoid / rhabdoid tumor -3.300 4.2e-04
medulloblastoma, large-cell -4.300 1.0e-05
primitive neuroectodermal tumor -1.900 2.7e-02
adrenocortical adenoma -1.453 1.3e-06
adrenocortical carcinoma -1.360 1.2e-02
tuberculosis and treatment for 3 months 1.800 1.1e-03
non-small cell lung cancer -2.312 3.2e-21
intraductal papillary-mucinous adenoma (... -1.700 1.9e-06
intraductal papillary-mucinous carcinoma... -1.800 4.8e-06
intraductal papillary-mucinous neoplasm ... -2.100 6.3e-05
colon cancer -1.700 7.0e-04
lung cancer -1.400 4.2e-04
breast carcinoma -1.300 2.2e-14
fibroadenoma -1.600 2.3e-02
pediatric high grade glioma -2.600 2.5e-05
subependymal giant cell astrocytoma -1.179 4.7e-02
lung adenocarcinoma -1.300 2.2e-10
psoriasis -1.100 1.0e-05
lung carcinoma 2.200 1.6e-09
Pick disease 1.400 3.5e-02
Breast cancer -1.500 1.7e-09
ductal carcinoma in situ -3.100 1.4e-04
invasive ductal carcinoma -3.600 6.0e-04
ovarian cancer -3.900 4.1e-16

Gene RIF (6)

PMID Text
25869928 Loss of PCDH9 is associated with the differentiation of tumor cells and metastasis in gastric cancer
25172662 Protocadherin 9 inhibits epithelial-mesenchymal transition and cell migration through activating GSK-3beta in hepatocellular carcinoma.
22300792 Our results suggest that PCDH9 might function as a tumor suppressor during cancer development and progression
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKA      1 - 70
GDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAP     71 - 140
MFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNL    141 - 210
DREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDAD    211 - 280
IGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTD    281 - 350
VNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYL    351 - 420
LETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT    421 - 490
ISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIV    491 - 560
TVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSN    561 - 630
VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEV    631 - 700
FAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLV    701 - 770
FLYVNDTAGNASYIYDLIRRTMETPLDRNIGDSSQPYQNEDYLTIMIAIIAGAMVVIVVIFVTVLVRCRH    771 - 840
ASRFKAAQRSKQGAEWMSPNQENKQNKKKKRKKRKSPKSSLLNFVTIEESKPDDAVHEPINGTISLPAEL    841 - 910
EEQSIGRFDWGPAPPTTFKPNSPDLAKHYKSASPQPAFHLKPDTPVSVKKHHVIQELPLDNTFVGGCDTL    911 - 980
SKRSSTSSDHFSASECSSQGGFKTKGPLHTRQCNSHSKSDNIPVTPQKCPSSTGFHIQENEESHYESQRR    981 - 1050
VTFHLPDGSQESCSDSGLGDHEPVGSGTLISHPLPLVQPQDEFYDQASPDKRTEADGNSDPNSDGPLGPR   1051 - 1120
GLAEATEMCTQECLVLGHSDNCWMPPGLGPYQHPKSPLSTFAPQKEWVKKDKLVNGHTLTRAWKEDSNRN   1121 - 1190
QFNDRKQYGSNEGHFNNGSHMTDIPLANLKSYKQAGGATESPKEHQL                          1191 - 1237
//

Text Mined References (22)

PMID Year Title
25869928 2015 Loss of PCDH9 is associated with the differentiation of tumor cells and metastasis and predicts poor survival in gastric cancer.
25172662 2014 Protocadherin 9 inhibits epithelial-mesenchymal transition and cell migration through activating GSK-3? in hepatocellular carcinoma.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22633400 2012 Genome-wide association study identifies candidate genes for male fertility traits in humans.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
22300792 2012 Downregulation of PCDH9 predicts prognosis for patients with glioma.
21844884 2013 Genome-wide meta-analysis identifies variants associated with platinating agent susceptibility across populations.
21552555 2011 A genome-wide association study on obesity and obesity-related traits.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
10716726 2000 Large exons encoding multiple ectodomains are a characteristic feature of protocadherin genes.
9787079 1998 Characterization of two novel protocadherins (PCDH8 and PCDH9) localized on human chromosome 13 and mouse chromosome 14.