Property Summary

NCBI Gene PubMed Count 22
PubMed Score 22.94
PubTator Score 10.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Epilepsy 346
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 2.0
Orofacial cleft 38 0.0 1.0
Disease Target Count Z-score Confidence
Idiopathic generalized epilepsy 15 3.197 1.6

Expression

  Differential Expression (32)

Disease log2 FC p
malignant mesothelioma -3.900 1.7e-08
cutaneous lupus erythematosus -1.600 7.7e-05
psoriasis -2.100 1.3e-04
astrocytoma -1.600 1.1e-08
glioblastoma -3.400 4.3e-03
oligodendroglioma -1.400 1.8e-06
osteosarcoma 2.475 2.3e-03
ependymoma -2.500 4.1e-04
medulloblastoma -2.500 2.6e-03
non diabetic and post-ischemic heart fai... -1.400 4.7e-03
type II diabetes mellitus and post-ische... -1.400 1.2e-02
atypical teratoid / rhabdoid tumor 2.900 7.4e-04
medulloblastoma, large-cell -5.400 1.8e-03
primitive neuroectodermal tumor -2.800 3.6e-02
Duchenne muscular dystrophy 1.043 2.9e-07
primary pancreatic ductal adenocarcinoma 2.701 9.8e-04
non-small cell lung cancer 2.018 4.2e-13
intraductal papillary-mucinous neoplasm ... 3.700 2.0e-02
colon cancer -2.100 8.2e-04
active Crohn's disease 1.050 3.6e-02
pancreatic cancer 2.300 5.1e-03
adult high grade glioma -2.600 6.6e-03
pilocytic astrocytoma 1.300 1.4e-06
aldosterone-producing adenoma -1.158 6.2e-03
lung adenocarcinoma 1.500 4.2e-04
invasive ductal carcinoma 1.500 1.6e-02
Breast cancer -2.400 1.8e-07
ulcerative colitis 1.600 2.0e-02
ovarian cancer 3.700 4.4e-05
chronic rhinosinusitis -1.334 3.5e-02
cystic fibrosis and chronic rhinosinusit... -1.116 2.4e-02
head and neck cancer -1.400 4.7e-02

 GO Function (1)

Gene RIF (6)

PMID Text
25446128 Pcdh7 plays a key role in osteoclastogenesis by promoting cell-cell fusion
24614497 Two SNPs rs13146789 and rs13109270 of PCDH7 showed strong association with musical aptitude and inner ear development and neurocognitive functions.
23751349 PCDH7 is up-regulation in bone metastatic breast cancer tissues.
23369722 Methylation of polycomb groups target genes is an early event in urothelial carcinogenesis in young patients.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19414679 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MLRMRTAGWARGWCLGCCLLLPLSLSLAAAKQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLES      1 - 70
GSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNT     71 - 140
PTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELLQEPGGGGSGGESRRAGAADSAPYPGGG    141 - 210
GNGASGGGSGGSKRRLDASEGGGGTNPGGRSSVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRV    211 - 280
RDGGDPPRSSQAILRVLITDVNDNSPRFEKSVYEADLAENSAPGTPILQLRAADLDVGVNGQIEYVFGAA    281 - 350
TESVRRLLRLDETSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKI    351 - 420
GRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQNKKKYFLHTS    421 - 490
TPLDYEATREFNVVIVAVDSGSPSLSSNNSLIVKVGDTNDNPPMFGQSVVEVYFPENNIPGERVATVLAT    491 - 560
DADSGKNAEIAYSLDSSVMGIFAIDPDSGDILVNTVLDREQTDRYEFKVNAKDKGIPVLQGSTTVIVQVA    561 - 630
DKNDNDPKFMQDVFTFYVKENLQPNSPVGMVTVMDADKGRNAEMSLYIEENNNIFSIENDTGTIYSTMSF    631 - 700
DREHQTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTLPKNISYTLLPPSSNVRTVVATVLATD    701 - 770
SDDGINADLNYSIVGGNPFKLFEIDPTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVN    771 - 840
ESVSNATAIDSQIARSLHIPLTQDIAGDPSYEISKQRLSIVIGVVAGIMTVILIILIVVMARYCRSKNKN    841 - 910
GYEAGKKDHEDFFTPQQHDKSKKPKKDKKNKKSKQPLYSSIVTVEASKPNGQRYDSVNEKLSDSPSMGRY    911 - 980
RSVNGGPGSPDLARHYKSSSPLPTVQLHPQSPTAGKKHQAVQDLPPANTFVGAGDNISIGSDHCSEYSCQ    981 - 1050
TNNKYSKQMRLHPYITVFG                                                      1051 - 1069
//

Text Mined References (27)

PMID Year Title
25446128 2014 Global epigenomic analysis indicates protocadherin-7 activates osteoclastogenesis by promoting cell-cell fusion.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25367360 2015 Genome-wide association study for refractive astigmatism reveals genetic co-determination with spherical equivalent refractive error: the CREAM consortium.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
25087078 2014 Genetic determinants of common epilepsies: a meta-analysis of genome-wide association studies.
24614497 2015 A genome-wide linkage and association study of musical aptitude identifies loci containing genes related to inner ear development and neurocognitive functions.
23751349 2013 Protocadherin-7 induces bone metastasis of breast cancer.
23369722 2013 Hypermethylation of the polycomb group target gene PCDH7 in bladder tumors from patients of all ages.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22028671 2011 A genome-wide screen for interactions reveals a new locus on 4p15 modifying the effect of waist-to-hip ratio on total cholesterol.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19414679 2009 Genome-wide analysis of survival in early-stage non-small-cell lung cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
10716726 2000 Large exons encoding multiple ectodomains are a characteristic feature of protocadherin genes.
10571067 1999 BH-protocadherin-c, a member of the cadherin superfamily, interacts with protein phosphatase 1 alpha through its intracellular domain.
9615233 1998 Cloning, expression analysis, and chromosomal localization of BH-protocadherin (PCDH7), a novel member of the cadherin superfamily.