Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.26
PubTator Score 4.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6514 2.2e-09
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.0
lung cancer 4607 0.0 0.6
Disease Target Count Z-score Confidence
Schizophrenia 1136 0.0 1.2
Disease Target Count Z-score Confidence
Trichorhinophalangeal syndrome type I 8 4.173 2.1

Gene RIF (3)

AA Sequence

MRGRGNARSSQALGVSWCPATWHPRLDMGRLHRPRSSTSYRNLPHLFLFFLFVGPFSCLGSYSRATELLY      1 - 70
SLNEGLPAGVLIGSLAEDLRLLPRSAGRPDPQSQLPERTGAEWNPPLSFSLASRGLSGQYVTLDNRSGEL     71 - 140
HTSAQEIDREALCVEGGGGTAWSGSVSISSSPSDSCLLLLDVLVLPQEYFRFVKVKIAIRDINDNAPQFP    141 - 210
VSQISVWVPENAPVNTRLAIEHPAVDPDVGINGVQTYRLLDYHGMFTLDVEENENGERTPYLIVMGALDR    211 - 280
ETQDQYVSIIIAEDGGSPPLLGSATLTIGISDINDNCPLFTDSQINVTVYGNATVGTPIAAVQAVDKDLG    281 - 350
TNAQITYSYSQKVPQASKDLFHLDENTGVIKLFSKIGGSVLESHKLTILANGPGCIPAVITALVSIIKVI    351 - 420
FRPPEIVPRYIANEIDGVVYLKELEPVNTPIAFFTIRDPEGKYKVNCYLDGEGPFRLSPYKPYNNEYLLE    421 - 490
TTKPMDYELQQFYEVAVVAWNSEGFHVKRVIKVQLLDDNDNAPIFLQPLIELTIEENNSPNAFLTKLYAT    491 - 560
DADSEERGQVSYFLGPDAPSYFSLDSVTGILTVSTQLDREEKEKYRYTVRAVDCGKPPRESVATVALTVL    561 - 630
DKNDNSPRFINKDFSFFVPENFPGYGEIGVISVTDADAGRNGWVALSVVNQSDIFVIDTGKGMLRAKVSL    631 - 700
DREQQSSYTLWVEAVDGGEPALSSTAKITILLLDINDNPPLVLFPQSNMSYLLVLPSTLPGSPVTEVYAV    701 - 770
DKDTGMNAVIAYSIIGRRGPRPESFRIDPKTGNITLEEALLQTDYGLHRLLVKVSDHGYPEPLHSTVMVN    771 - 840
LFVNDTVSNESYIESLLRKEPEINIEEKEPQISIEPTHRKVESVSCMPTLVALSVISLGSITLVTGMGIY    841 - 910
ICLRKGEKHPREDENLEVQIPLKGKIDLHMRERKPMDISNI                                 911 - 951
//

Text Mined References (20)

PMID Year Title